Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DD25

Protein Details
Accession B0DD25   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-38SAPAAEKPRRRKAKEAASGEHydrophilic
74-96TTTVKLPRQKRAKKAKENETAPKHydrophilic
NLS Segment(s)
PositionSequence
25-32KPRRRKAK
60-98KKGRPKKEKDAAKSTTTVKLPRQKRAKKAKENETAPKPK
Subcellular Location(s) cyto 14.5, cyto_nucl 12.833, nucl 10, mito_nucl 6.833
Family & Domain DBs
KEGG lbc:LACBIDRAFT_298540  -  
Amino Acid Sequences MGSSDVLDSSSTAIAGNDSAPAAEKPRRRKAKEAASGEPTQEGLSGTTEPTQEASVSSVKKGRPKKEKDAAKSTTTVKLPRQKRAKKAKENETAPKPKALPVPTPNPPTWKLVPMLKPKVKQAKFTSTDVQTKVSGPTGTVAPKFTPRIWSSSRDELFAVMPELTGTKCVNGVSWMCSQNPYILLEEAGKSFGVSAGDGKPCFGVDNVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.08
8 0.09
9 0.14
10 0.2
11 0.27
12 0.36
13 0.47
14 0.58
15 0.62
16 0.7
17 0.75
18 0.79
19 0.82
20 0.79
21 0.75
22 0.71
23 0.67
24 0.58
25 0.48
26 0.38
27 0.28
28 0.21
29 0.15
30 0.1
31 0.1
32 0.09
33 0.09
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.09
40 0.09
41 0.11
42 0.13
43 0.14
44 0.16
45 0.19
46 0.22
47 0.3
48 0.37
49 0.45
50 0.51
51 0.58
52 0.67
53 0.72
54 0.78
55 0.78
56 0.79
57 0.74
58 0.66
59 0.61
60 0.54
61 0.5
62 0.43
63 0.39
64 0.37
65 0.41
66 0.44
67 0.5
68 0.58
69 0.6
70 0.67
71 0.75
72 0.78
73 0.8
74 0.84
75 0.85
76 0.84
77 0.82
78 0.8
79 0.78
80 0.74
81 0.65
82 0.59
83 0.49
84 0.43
85 0.42
86 0.37
87 0.34
88 0.31
89 0.36
90 0.38
91 0.41
92 0.39
93 0.38
94 0.37
95 0.35
96 0.32
97 0.28
98 0.24
99 0.26
100 0.32
101 0.37
102 0.44
103 0.45
104 0.45
105 0.5
106 0.58
107 0.55
108 0.56
109 0.53
110 0.54
111 0.53
112 0.54
113 0.53
114 0.47
115 0.5
116 0.43
117 0.39
118 0.3
119 0.27
120 0.25
121 0.22
122 0.17
123 0.12
124 0.13
125 0.13
126 0.14
127 0.14
128 0.15
129 0.14
130 0.18
131 0.21
132 0.2
133 0.25
134 0.24
135 0.3
136 0.31
137 0.36
138 0.38
139 0.44
140 0.44
141 0.38
142 0.37
143 0.32
144 0.29
145 0.24
146 0.2
147 0.1
148 0.09
149 0.08
150 0.09
151 0.08
152 0.09
153 0.09
154 0.08
155 0.09
156 0.09
157 0.1
158 0.13
159 0.14
160 0.15
161 0.2
162 0.22
163 0.22
164 0.24
165 0.24
166 0.23
167 0.23
168 0.21
169 0.18
170 0.17
171 0.17
172 0.17
173 0.18
174 0.16
175 0.15
176 0.13
177 0.1
178 0.1
179 0.1
180 0.09
181 0.09
182 0.11
183 0.15
184 0.2
185 0.2
186 0.2
187 0.19
188 0.19
189 0.2