Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CXG0

Protein Details
Accession S3CXG0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
255-274NGEGKKGKGKRKVENGTPESBasic
NLS Segment(s)
PositionSequence
252-270ANGNGEGKKGKGKRKVENG
280-287KTQAKKRR
Subcellular Location(s) cyto_mito 11.166, cyto 11, cyto_nucl 9.666, mito 9, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016195  Pol/histidinol_Pase-like  
IPR002738  RNase_P_p30  
Gene Ontology GO:0008033  P:tRNA processing  
KEGG glz:GLAREA_08373  -  
Pfam View protein in Pfam  
PF01876  RNase_P_p30  
Amino Acid Sequences MIYDLNVPWTSSTPPATLSRTINFLNSLGYETIALSHFLNASSLPSQITNPIPLSIPTPPNTTILRRCTLILSDPAQNPRLTALAQAFDILALRPTTEKAYLSACNTMPEISILSLDLTQKFSWHFKPKPLMTAVTRGVRIELNYAQATSGDSAARRNFISNAMAIIRGTRGRGLIISSEAQDVLGVRAPADVVNLLSIWGLGSERGVESMSGNPRSVVVNEGIKRRGFRGVVDVVYGGERPASASKAKENANGNGEGKKGKGKRKVENGTPESTPPLSKTQAKKRRLEALKASKESSATPTPRDTPDAASDSTPKSKAHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.29
4 0.32
5 0.34
6 0.32
7 0.34
8 0.34
9 0.32
10 0.29
11 0.26
12 0.22
13 0.19
14 0.19
15 0.15
16 0.15
17 0.13
18 0.11
19 0.13
20 0.12
21 0.12
22 0.09
23 0.1
24 0.11
25 0.1
26 0.11
27 0.09
28 0.12
29 0.11
30 0.12
31 0.11
32 0.12
33 0.12
34 0.16
35 0.18
36 0.18
37 0.18
38 0.19
39 0.19
40 0.18
41 0.21
42 0.22
43 0.24
44 0.23
45 0.26
46 0.26
47 0.29
48 0.32
49 0.35
50 0.36
51 0.37
52 0.38
53 0.35
54 0.35
55 0.33
56 0.32
57 0.29
58 0.26
59 0.24
60 0.27
61 0.29
62 0.32
63 0.33
64 0.31
65 0.28
66 0.24
67 0.23
68 0.17
69 0.16
70 0.14
71 0.13
72 0.13
73 0.13
74 0.11
75 0.1
76 0.1
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.08
83 0.1
84 0.11
85 0.12
86 0.12
87 0.15
88 0.17
89 0.19
90 0.21
91 0.19
92 0.19
93 0.19
94 0.18
95 0.15
96 0.13
97 0.11
98 0.08
99 0.07
100 0.06
101 0.06
102 0.07
103 0.08
104 0.09
105 0.1
106 0.1
107 0.11
108 0.13
109 0.16
110 0.22
111 0.3
112 0.31
113 0.35
114 0.44
115 0.44
116 0.47
117 0.46
118 0.43
119 0.35
120 0.39
121 0.36
122 0.3
123 0.3
124 0.25
125 0.23
126 0.2
127 0.19
128 0.16
129 0.13
130 0.13
131 0.13
132 0.13
133 0.12
134 0.11
135 0.11
136 0.09
137 0.09
138 0.06
139 0.06
140 0.09
141 0.1
142 0.11
143 0.11
144 0.11
145 0.11
146 0.12
147 0.13
148 0.1
149 0.1
150 0.09
151 0.09
152 0.08
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.08
162 0.07
163 0.09
164 0.09
165 0.09
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.06
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.03
187 0.03
188 0.04
189 0.03
190 0.03
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.06
197 0.11
198 0.16
199 0.17
200 0.17
201 0.17
202 0.17
203 0.18
204 0.18
205 0.15
206 0.12
207 0.18
208 0.21
209 0.25
210 0.27
211 0.28
212 0.28
213 0.28
214 0.31
215 0.25
216 0.23
217 0.26
218 0.26
219 0.25
220 0.24
221 0.23
222 0.17
223 0.17
224 0.16
225 0.1
226 0.06
227 0.06
228 0.07
229 0.08
230 0.1
231 0.12
232 0.14
233 0.19
234 0.25
235 0.27
236 0.31
237 0.34
238 0.36
239 0.38
240 0.4
241 0.37
242 0.33
243 0.33
244 0.28
245 0.25
246 0.29
247 0.32
248 0.37
249 0.45
250 0.52
251 0.6
252 0.69
253 0.77
254 0.77
255 0.81
256 0.77
257 0.71
258 0.65
259 0.57
260 0.5
261 0.43
262 0.35
263 0.27
264 0.28
265 0.29
266 0.35
267 0.43
268 0.5
269 0.58
270 0.66
271 0.7
272 0.72
273 0.77
274 0.77
275 0.76
276 0.76
277 0.77
278 0.79
279 0.74
280 0.69
281 0.6
282 0.54
283 0.48
284 0.43
285 0.41
286 0.35
287 0.35
288 0.39
289 0.42
290 0.44
291 0.46
292 0.42
293 0.37
294 0.4
295 0.4
296 0.36
297 0.34
298 0.35
299 0.36
300 0.4
301 0.38