Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CJ34

Protein Details
Accession S3CJ34   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
133-154NGGRRAAYRTSRKPRSREATSHHydrophilic
NLS Segment(s)
PositionSequence
144-147RKPR
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
KEGG glz:GLAREA_01692  -  
Amino Acid Sequences MRVVNEGGVRGKTLKRIRGRLEEQKILGPGQRRLKAPPGSDNVNPFGSLQQPMSLWGGGGHHGMGGWWMVVMDQARQDKTFSLVAENERNSPGTVPGTVLYREQRGTGAMQGLHLGESSSMTSEQGGKAASSNGGRRAAYRTSRKPRSREATSHGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.56
4 0.62
5 0.68
6 0.74
7 0.75
8 0.76
9 0.73
10 0.66
11 0.61
12 0.55
13 0.46
14 0.41
15 0.35
16 0.35
17 0.38
18 0.41
19 0.39
20 0.42
21 0.49
22 0.52
23 0.5
24 0.5
25 0.46
26 0.46
27 0.47
28 0.46
29 0.4
30 0.35
31 0.32
32 0.25
33 0.21
34 0.18
35 0.16
36 0.13
37 0.11
38 0.11
39 0.12
40 0.13
41 0.11
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.07
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.08
61 0.1
62 0.11
63 0.11
64 0.12
65 0.11
66 0.13
67 0.14
68 0.11
69 0.11
70 0.12
71 0.15
72 0.19
73 0.19
74 0.18
75 0.17
76 0.18
77 0.16
78 0.15
79 0.14
80 0.1
81 0.1
82 0.09
83 0.09
84 0.11
85 0.11
86 0.13
87 0.13
88 0.14
89 0.15
90 0.14
91 0.14
92 0.13
93 0.14
94 0.13
95 0.14
96 0.12
97 0.12
98 0.12
99 0.11
100 0.1
101 0.09
102 0.08
103 0.05
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.09
115 0.1
116 0.11
117 0.13
118 0.16
119 0.19
120 0.23
121 0.26
122 0.26
123 0.27
124 0.31
125 0.35
126 0.41
127 0.47
128 0.53
129 0.6
130 0.71
131 0.78
132 0.8
133 0.83
134 0.83
135 0.82
136 0.79