Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3ED33

Protein Details
Accession S3ED33    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-47GARETRPQQHWKKLRQKYAKRSRKTICHydrophilic
NLS Segment(s)
PositionSequence
33-41KLRQKYAKR
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
KEGG glz:GLAREA_05541  -  
Amino Acid Sequences MGCLIRQHSLLALVRDDKQLGARETRPQQHWKKLRQKYAKRSRKTICLQTVSSAPFPWRAVGPWIGNMDINFDVIVKGTARPKIHGNKKTNTVEEEGGIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.2
5 0.21
6 0.24
7 0.24
8 0.26
9 0.27
10 0.33
11 0.4
12 0.46
13 0.47
14 0.52
15 0.58
16 0.63
17 0.69
18 0.72
19 0.75
20 0.77
21 0.82
22 0.83
23 0.85
24 0.86
25 0.88
26 0.88
27 0.83
28 0.83
29 0.77
30 0.76
31 0.72
32 0.69
33 0.65
34 0.59
35 0.54
36 0.46
37 0.45
38 0.37
39 0.31
40 0.23
41 0.17
42 0.14
43 0.14
44 0.14
45 0.11
46 0.1
47 0.12
48 0.15
49 0.15
50 0.16
51 0.17
52 0.16
53 0.16
54 0.15
55 0.16
56 0.13
57 0.12
58 0.09
59 0.08
60 0.08
61 0.08
62 0.09
63 0.06
64 0.09
65 0.13
66 0.19
67 0.2
68 0.23
69 0.31
70 0.4
71 0.5
72 0.57
73 0.6
74 0.62
75 0.7
76 0.75
77 0.71
78 0.64
79 0.58
80 0.5