Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DCC6

Protein Details
Accession S3DCC6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-80QFLHAVKKKTKIPPPPKVQPPKVQPPKVQPPKVNPQKPKHydrophilic
NLS Segment(s)
PositionSequence
48-79KKKTKIPPPPKVQPPKVQPPKVQPPKVNPQKP
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_05420  -  
Amino Acid Sequences MSAFSRGCLLRAHLLKRPAQSCQSTFLLIAQPAAPRSFSSSQFLHAVKKKTKIPPPPKVQPPKVQPPKVQPPKVNPQKPKLPTPTKAAEPANNDYVPHAYAKKLSELPEPTLLYEAPSHTTLRTVSYISTAFFISYGAYCGFTYIEPHPEAPKWVALTFGTGAFILFTMGGWLSTCPAGIIKTLRVIPKRIVLEKRMVGPQLAQRLPDLVLEAEIRKTLPLPFLPNRKFYLDPHDMQVPEALCPPLTPSEAAKFKAFEQQMKATAQQQAEYNAKHKLASLGTRFSKWNYNVFQAVKRAWTREGFMVIRFVGLKGGREVSSAFKLDVMEGAYALDQGKAIDRLADIRRVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.56
4 0.55
5 0.53
6 0.54
7 0.56
8 0.51
9 0.51
10 0.48
11 0.41
12 0.38
13 0.34
14 0.31
15 0.24
16 0.24
17 0.2
18 0.2
19 0.2
20 0.21
21 0.19
22 0.15
23 0.22
24 0.25
25 0.26
26 0.28
27 0.27
28 0.29
29 0.34
30 0.35
31 0.36
32 0.39
33 0.45
34 0.46
35 0.52
36 0.57
37 0.61
38 0.69
39 0.71
40 0.75
41 0.77
42 0.81
43 0.84
44 0.87
45 0.88
46 0.86
47 0.85
48 0.83
49 0.84
50 0.85
51 0.82
52 0.78
53 0.77
54 0.81
55 0.82
56 0.81
57 0.76
58 0.73
59 0.77
60 0.81
61 0.81
62 0.77
63 0.75
64 0.77
65 0.76
66 0.77
67 0.76
68 0.73
69 0.68
70 0.68
71 0.65
72 0.58
73 0.6
74 0.53
75 0.48
76 0.45
77 0.45
78 0.43
79 0.38
80 0.35
81 0.29
82 0.27
83 0.23
84 0.2
85 0.16
86 0.12
87 0.16
88 0.17
89 0.2
90 0.22
91 0.23
92 0.28
93 0.29
94 0.32
95 0.33
96 0.32
97 0.28
98 0.26
99 0.24
100 0.19
101 0.17
102 0.15
103 0.12
104 0.13
105 0.13
106 0.12
107 0.13
108 0.12
109 0.14
110 0.14
111 0.12
112 0.11
113 0.13
114 0.13
115 0.12
116 0.13
117 0.1
118 0.09
119 0.08
120 0.08
121 0.06
122 0.06
123 0.07
124 0.06
125 0.07
126 0.07
127 0.08
128 0.08
129 0.07
130 0.1
131 0.1
132 0.13
133 0.13
134 0.14
135 0.16
136 0.16
137 0.17
138 0.15
139 0.16
140 0.13
141 0.13
142 0.13
143 0.11
144 0.12
145 0.11
146 0.1
147 0.08
148 0.07
149 0.07
150 0.06
151 0.05
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.07
168 0.07
169 0.09
170 0.12
171 0.17
172 0.18
173 0.2
174 0.2
175 0.25
176 0.28
177 0.31
178 0.32
179 0.3
180 0.34
181 0.34
182 0.35
183 0.31
184 0.29
185 0.23
186 0.22
187 0.23
188 0.25
189 0.24
190 0.21
191 0.19
192 0.2
193 0.2
194 0.18
195 0.15
196 0.07
197 0.08
198 0.08
199 0.09
200 0.08
201 0.08
202 0.08
203 0.07
204 0.08
205 0.08
206 0.1
207 0.11
208 0.18
209 0.23
210 0.33
211 0.36
212 0.39
213 0.41
214 0.42
215 0.42
216 0.37
217 0.4
218 0.36
219 0.35
220 0.34
221 0.36
222 0.32
223 0.3
224 0.31
225 0.22
226 0.17
227 0.18
228 0.15
229 0.1
230 0.1
231 0.12
232 0.11
233 0.12
234 0.12
235 0.13
236 0.2
237 0.23
238 0.25
239 0.25
240 0.24
241 0.24
242 0.32
243 0.32
244 0.28
245 0.3
246 0.32
247 0.34
248 0.35
249 0.36
250 0.31
251 0.34
252 0.31
253 0.27
254 0.25
255 0.26
256 0.28
257 0.28
258 0.27
259 0.27
260 0.26
261 0.25
262 0.24
263 0.23
264 0.23
265 0.28
266 0.3
267 0.33
268 0.35
269 0.38
270 0.38
271 0.37
272 0.42
273 0.38
274 0.41
275 0.37
276 0.39
277 0.43
278 0.44
279 0.46
280 0.42
281 0.41
282 0.4
283 0.4
284 0.39
285 0.37
286 0.36
287 0.35
288 0.34
289 0.38
290 0.32
291 0.3
292 0.3
293 0.26
294 0.25
295 0.22
296 0.19
297 0.18
298 0.17
299 0.18
300 0.18
301 0.21
302 0.2
303 0.2
304 0.22
305 0.22
306 0.25
307 0.25
308 0.22
309 0.2
310 0.2
311 0.2
312 0.2
313 0.17
314 0.12
315 0.11
316 0.11
317 0.1
318 0.1
319 0.1
320 0.09
321 0.07
322 0.07
323 0.11
324 0.12
325 0.12
326 0.13
327 0.13
328 0.19
329 0.23