Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CXU8

Protein Details
Accession S3CXU8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23GGNGAKSKRDREKKAAKEGSGBasic
NLS Segment(s)
PositionSequence
8-19KSKRDREKKAAK
Subcellular Location(s) mito 13, nucl 9, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG glz:GLAREA_08514  -  
Amino Acid Sequences MGGGNGAKSKRDREKKAAKEGSGVAKSQLKVNEQAKDIQCVTCKNFSNTHKTSTAKQWKTVFQISENRLGTEGLTNEWRHDTDAGWWQIVALKGVNGTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.85
4 0.83
5 0.74
6 0.68
7 0.64
8 0.62
9 0.53
10 0.44
11 0.36
12 0.33
13 0.32
14 0.32
15 0.31
16 0.24
17 0.3
18 0.33
19 0.35
20 0.31
21 0.38
22 0.34
23 0.35
24 0.34
25 0.28
26 0.26
27 0.25
28 0.26
29 0.26
30 0.27
31 0.25
32 0.31
33 0.33
34 0.4
35 0.38
36 0.39
37 0.37
38 0.37
39 0.37
40 0.41
41 0.48
42 0.41
43 0.45
44 0.45
45 0.44
46 0.48
47 0.49
48 0.4
49 0.34
50 0.4
51 0.37
52 0.42
53 0.38
54 0.34
55 0.3
56 0.29
57 0.25
58 0.19
59 0.18
60 0.12
61 0.15
62 0.15
63 0.16
64 0.18
65 0.18
66 0.18
67 0.18
68 0.16
69 0.17
70 0.25
71 0.25
72 0.23
73 0.23
74 0.21
75 0.23
76 0.24
77 0.2
78 0.12
79 0.11
80 0.14