Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CE35

Protein Details
Accession S3CE35   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-45PSSVASPRRKSSRREKSQRSQKPTTFNHHydrophilic
NLS Segment(s)
PositionSequence
25-33RRKSSRREK
Subcellular Location(s) nucl 11, plas 9, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_08116  -  
Amino Acid Sequences MSKESGAESSQVAHVRDPSSVASPRRKSSRREKSQRSQKPTTFNHPILDDTSMNTAEILVLVTIAVGSVIIYLAIFPPEEEKEQLSTSIFNRPEEPIPEPSVTKDGKKYSTVWPNVPEKHRKCEDGGRHSGSLEVVTWETPEQGLGWGATEADESPSLKAEFEEEMKCNFEKFYEAWPMGFRWTCCGNPGDYKWGCDHHFYPGCRCDNCRFGYRLPAGFLDERNKSPHAKGLSLGQGNVHGQQIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.23
4 0.23
5 0.21
6 0.23
7 0.29
8 0.34
9 0.4
10 0.45
11 0.52
12 0.6
13 0.64
14 0.67
15 0.71
16 0.76
17 0.77
18 0.82
19 0.85
20 0.86
21 0.92
22 0.94
23 0.91
24 0.9
25 0.84
26 0.83
27 0.79
28 0.77
29 0.75
30 0.67
31 0.61
32 0.53
33 0.48
34 0.4
35 0.37
36 0.28
37 0.21
38 0.21
39 0.18
40 0.16
41 0.14
42 0.12
43 0.08
44 0.08
45 0.07
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.06
65 0.08
66 0.1
67 0.11
68 0.12
69 0.14
70 0.14
71 0.15
72 0.13
73 0.13
74 0.13
75 0.2
76 0.2
77 0.19
78 0.2
79 0.21
80 0.23
81 0.24
82 0.26
83 0.22
84 0.23
85 0.24
86 0.22
87 0.21
88 0.24
89 0.22
90 0.21
91 0.22
92 0.23
93 0.24
94 0.26
95 0.27
96 0.3
97 0.38
98 0.39
99 0.36
100 0.38
101 0.42
102 0.45
103 0.47
104 0.5
105 0.44
106 0.48
107 0.48
108 0.45
109 0.42
110 0.45
111 0.48
112 0.46
113 0.49
114 0.44
115 0.42
116 0.4
117 0.38
118 0.3
119 0.22
120 0.14
121 0.09
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.05
140 0.06
141 0.06
142 0.06
143 0.08
144 0.09
145 0.08
146 0.08
147 0.09
148 0.1
149 0.12
150 0.14
151 0.14
152 0.15
153 0.17
154 0.18
155 0.16
156 0.15
157 0.13
158 0.13
159 0.13
160 0.17
161 0.21
162 0.21
163 0.22
164 0.23
165 0.23
166 0.25
167 0.26
168 0.21
169 0.18
170 0.22
171 0.21
172 0.22
173 0.23
174 0.22
175 0.26
176 0.28
177 0.33
178 0.3
179 0.32
180 0.32
181 0.35
182 0.34
183 0.33
184 0.32
185 0.32
186 0.38
187 0.38
188 0.43
189 0.46
190 0.5
191 0.47
192 0.51
193 0.47
194 0.48
195 0.5
196 0.49
197 0.45
198 0.42
199 0.49
200 0.5
201 0.46
202 0.41
203 0.38
204 0.37
205 0.35
206 0.37
207 0.34
208 0.33
209 0.33
210 0.35
211 0.36
212 0.35
213 0.35
214 0.38
215 0.37
216 0.34
217 0.33
218 0.36
219 0.42
220 0.4
221 0.38
222 0.32
223 0.31
224 0.3
225 0.31