Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3DYI0

Protein Details
Accession S3DYI0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
174-200KEKVEKYREGKEKDRIKKLEKESEKKDBasic
NLS Segment(s)
PositionSequence
176-199KVEKYREGKEKDRIKKLEKESEKK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015222  Tam41  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004605  F:phosphatidate cytidylyltransferase activity  
GO:0032049  P:cardiolipin biosynthetic process  
GO:0016024  P:CDP-diacylglycerol biosynthetic process  
KEGG glz:GLAREA_12716  -  
Pfam View protein in Pfam  
PF09139  Tam41_Mmp37  
Amino Acid Sequences MGDPRMALPTEDKSKVANIVGNNLPNFRRLYAPLIENLPNVGFNDSKCTSPDWALDPTLNARLTQDMSPIKRGNMVRRLPKFFRSKLYFQYQKKYQIPQLEFNKMLEASSDESGTRINRREGGGFEQRIASEPPEELRGEIRGVIKSTVSWPSTSQSLKGPVTAGAARTWRYMKEKVEKYREGKEKDRIKKLEKESEKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.31
4 0.28
5 0.22
6 0.26
7 0.29
8 0.32
9 0.31
10 0.31
11 0.3
12 0.29
13 0.3
14 0.25
15 0.24
16 0.22
17 0.26
18 0.27
19 0.28
20 0.28
21 0.3
22 0.3
23 0.27
24 0.25
25 0.21
26 0.17
27 0.16
28 0.15
29 0.12
30 0.11
31 0.18
32 0.18
33 0.19
34 0.19
35 0.2
36 0.2
37 0.21
38 0.23
39 0.2
40 0.21
41 0.21
42 0.2
43 0.19
44 0.19
45 0.21
46 0.19
47 0.16
48 0.14
49 0.15
50 0.16
51 0.16
52 0.19
53 0.2
54 0.21
55 0.27
56 0.27
57 0.26
58 0.29
59 0.32
60 0.34
61 0.38
62 0.43
63 0.46
64 0.51
65 0.58
66 0.55
67 0.59
68 0.59
69 0.53
70 0.56
71 0.53
72 0.5
73 0.5
74 0.56
75 0.57
76 0.52
77 0.58
78 0.54
79 0.57
80 0.57
81 0.54
82 0.49
83 0.48
84 0.49
85 0.49
86 0.48
87 0.44
88 0.41
89 0.37
90 0.34
91 0.26
92 0.23
93 0.15
94 0.11
95 0.09
96 0.09
97 0.1
98 0.08
99 0.08
100 0.1
101 0.11
102 0.13
103 0.14
104 0.15
105 0.17
106 0.18
107 0.2
108 0.21
109 0.25
110 0.29
111 0.27
112 0.26
113 0.24
114 0.23
115 0.23
116 0.23
117 0.17
118 0.11
119 0.11
120 0.11
121 0.13
122 0.13
123 0.12
124 0.12
125 0.12
126 0.12
127 0.14
128 0.15
129 0.14
130 0.15
131 0.15
132 0.14
133 0.13
134 0.16
135 0.19
136 0.18
137 0.17
138 0.17
139 0.19
140 0.24
141 0.24
142 0.23
143 0.22
144 0.27
145 0.26
146 0.26
147 0.24
148 0.2
149 0.23
150 0.23
151 0.2
152 0.16
153 0.19
154 0.19
155 0.22
156 0.23
157 0.24
158 0.28
159 0.33
160 0.38
161 0.46
162 0.54
163 0.61
164 0.68
165 0.72
166 0.71
167 0.76
168 0.77
169 0.74
170 0.72
171 0.72
172 0.74
173 0.75
174 0.8
175 0.78
176 0.76
177 0.79
178 0.8
179 0.81
180 0.81