Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CSB7

Protein Details
Accession S3CSB7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDVLHydrophilic
81-111IFDRKEKGYRKSIRKLPKWTRVSQRLNPPGYHydrophilic
NLS Segment(s)
PositionSequence
87-96KGYRKSIRKL
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG glz:GLAREA_04755  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNSLGGGLLWKIPWRLSKFQKARQRKRLRAVDVLVATVDKALQRNGGMTTRAVERWKEEMPIEQVMVPKDKYTIFDRKEKGYRKSIRKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.12
5 0.12
6 0.15
7 0.21
8 0.26
9 0.34
10 0.41
11 0.51
12 0.58
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.88
22 0.83
23 0.78
24 0.7
25 0.64
26 0.54
27 0.45
28 0.35
29 0.25
30 0.19
31 0.12
32 0.11
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.1
40 0.11
41 0.1
42 0.1
43 0.11
44 0.11
45 0.13
46 0.13
47 0.12
48 0.13
49 0.17
50 0.17
51 0.18
52 0.17
53 0.18
54 0.2
55 0.21
56 0.19
57 0.16
58 0.17
59 0.17
60 0.19
61 0.16
62 0.14
63 0.14
64 0.14
65 0.16
66 0.2
67 0.28
68 0.29
69 0.38
70 0.4
71 0.46
72 0.54
73 0.59
74 0.6
75 0.61
76 0.67
77 0.68
78 0.75
79 0.77
80 0.79
81 0.8
82 0.85
83 0.85
84 0.86
85 0.84
86 0.82
87 0.84
88 0.84
89 0.84
90 0.81
91 0.82