Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0CXC2

Protein Details
Accession B0CXC2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77TVDPAKKVKPVKQGKKSGVRHydrophilic
NLS Segment(s)
PositionSequence
63-77KKVKPVKQGKKSGVR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_308846  -  
Amino Acid Sequences MPFFQGASGITISGGEFNDIAGDFTKTDSSVKTTNTDSYNTTSETLTNSNNDNSQRLTVDPAKKVKPVKQGKKSGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.07
9 0.08
10 0.07
11 0.08
12 0.08
13 0.08
14 0.09
15 0.09
16 0.12
17 0.14
18 0.15
19 0.16
20 0.18
21 0.21
22 0.21
23 0.22
24 0.2
25 0.2
26 0.21
27 0.19
28 0.19
29 0.15
30 0.14
31 0.14
32 0.14
33 0.13
34 0.13
35 0.14
36 0.14
37 0.17
38 0.18
39 0.18
40 0.18
41 0.18
42 0.18
43 0.17
44 0.21
45 0.26
46 0.3
47 0.35
48 0.4
49 0.41
50 0.46
51 0.52
52 0.53
53 0.56
54 0.62
55 0.66
56 0.7
57 0.77