Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CTI7

Protein Details
Accession S3CTI7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSEYWKSTPKYWCKHCKVFVRDTKLEHydrophilic
NLS Segment(s)
PositionSequence
283-293KKRKAKNIRQK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR040023  WBP4  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG glz:GLAREA_00133  -  
Amino Acid Sequences MSEYWKSTPKYWCKHCKVFVRDTKLEKTNHEATPRHQGNLKRFVRDIHRGHEKEEKDKERAKSEVARLNGLVAGGGSGASSSGSGFGRGPTPSVPKPQASAAQRKQQLAQLAELGVSIPDEFRPDMAMAGEWQVTSERVLEPDSETKVEAKAMGVKRERGEEEDDPEAAELKKKRWGSKFRAHPTEEDNADLDTLLIQATARSREPAIKPEVKTEDEKLEHIKSEIKVEPTPTACLLESGAANSSTEGVKEEEVPNILADIPDSDVTPKQEGVGQSATGIVFKKRKAKNIRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.84
5 0.84
6 0.84
7 0.82
8 0.8
9 0.77
10 0.76
11 0.72
12 0.67
13 0.6
14 0.58
15 0.56
16 0.54
17 0.55
18 0.49
19 0.46
20 0.54
21 0.53
22 0.48
23 0.46
24 0.47
25 0.49
26 0.57
27 0.57
28 0.51
29 0.49
30 0.52
31 0.55
32 0.58
33 0.53
34 0.51
35 0.57
36 0.54
37 0.56
38 0.59
39 0.55
40 0.54
41 0.6
42 0.57
43 0.54
44 0.6
45 0.61
46 0.58
47 0.57
48 0.53
49 0.5
50 0.52
51 0.51
52 0.46
53 0.43
54 0.38
55 0.36
56 0.31
57 0.23
58 0.16
59 0.09
60 0.07
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.05
70 0.06
71 0.07
72 0.07
73 0.08
74 0.11
75 0.11
76 0.12
77 0.13
78 0.19
79 0.2
80 0.27
81 0.29
82 0.28
83 0.3
84 0.31
85 0.35
86 0.34
87 0.42
88 0.41
89 0.47
90 0.5
91 0.49
92 0.48
93 0.44
94 0.44
95 0.35
96 0.3
97 0.23
98 0.19
99 0.17
100 0.16
101 0.12
102 0.07
103 0.05
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.07
117 0.07
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.07
127 0.08
128 0.09
129 0.12
130 0.12
131 0.12
132 0.12
133 0.12
134 0.11
135 0.11
136 0.09
137 0.07
138 0.13
139 0.14
140 0.2
141 0.21
142 0.23
143 0.24
144 0.27
145 0.27
146 0.23
147 0.26
148 0.22
149 0.24
150 0.22
151 0.21
152 0.18
153 0.17
154 0.16
155 0.11
156 0.14
157 0.13
158 0.13
159 0.2
160 0.23
161 0.3
162 0.38
163 0.47
164 0.51
165 0.59
166 0.68
167 0.7
168 0.75
169 0.69
170 0.63
171 0.58
172 0.55
173 0.46
174 0.37
175 0.29
176 0.21
177 0.19
178 0.17
179 0.12
180 0.06
181 0.06
182 0.04
183 0.04
184 0.03
185 0.04
186 0.06
187 0.09
188 0.09
189 0.1
190 0.12
191 0.18
192 0.2
193 0.25
194 0.31
195 0.35
196 0.36
197 0.41
198 0.45
199 0.41
200 0.43
201 0.4
202 0.39
203 0.34
204 0.35
205 0.33
206 0.3
207 0.28
208 0.26
209 0.29
210 0.22
211 0.27
212 0.28
213 0.28
214 0.28
215 0.29
216 0.33
217 0.29
218 0.3
219 0.26
220 0.24
221 0.2
222 0.19
223 0.17
224 0.14
225 0.13
226 0.11
227 0.12
228 0.1
229 0.1
230 0.1
231 0.1
232 0.09
233 0.09
234 0.1
235 0.1
236 0.1
237 0.14
238 0.15
239 0.16
240 0.17
241 0.17
242 0.16
243 0.15
244 0.14
245 0.1
246 0.1
247 0.08
248 0.09
249 0.09
250 0.1
251 0.11
252 0.14
253 0.17
254 0.19
255 0.18
256 0.17
257 0.21
258 0.21
259 0.24
260 0.23
261 0.2
262 0.18
263 0.19
264 0.19
265 0.17
266 0.18
267 0.19
268 0.22
269 0.28
270 0.37
271 0.42
272 0.52
273 0.61