Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DK45

Protein Details
Accession B0DK45    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-81SQKMDGRCRFWKKKNSKPKGYFKSQDSHydrophilic
NLS Segment(s)
PositionSequence
67-68KK
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_330053  -  
Amino Acid Sequences MPGCRGPLRIFERYYKVSLEARRDVWSLRPGQWEKKTQRTLGGMRTEGRRRVVASQKMDGRCRFWKKKNSKPKGYFKSQDSGVSGTGLVDYRHVYWKECGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.39
4 0.39
5 0.41
6 0.42
7 0.39
8 0.37
9 0.38
10 0.38
11 0.35
12 0.34
13 0.34
14 0.3
15 0.29
16 0.36
17 0.36
18 0.44
19 0.49
20 0.53
21 0.53
22 0.6
23 0.61
24 0.54
25 0.55
26 0.52
27 0.49
28 0.46
29 0.44
30 0.36
31 0.33
32 0.38
33 0.37
34 0.34
35 0.33
36 0.27
37 0.25
38 0.29
39 0.35
40 0.36
41 0.35
42 0.38
43 0.42
44 0.44
45 0.48
46 0.43
47 0.4
48 0.42
49 0.49
50 0.53
51 0.55
52 0.62
53 0.68
54 0.77
55 0.83
56 0.85
57 0.86
58 0.87
59 0.9
60 0.88
61 0.87
62 0.83
63 0.76
64 0.72
65 0.63
66 0.57
67 0.48
68 0.42
69 0.33
70 0.26
71 0.22
72 0.16
73 0.15
74 0.12
75 0.1
76 0.09
77 0.1
78 0.12
79 0.2
80 0.21
81 0.23