Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CZ79

Protein Details
Accession S3CZ79    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-127DLRPKQTRAIRRRLTKNESGKTLEKTKKRSVHFPQRKYAIKAHydrophilic
NLS Segment(s)
PositionSequence
88-116RPKQTRAIRRRLTKNESGKTLEKTKKRSV
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG glz:GLAREA_12333  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MRQSSGKVKTGQLWSKNKADLAKQLGELKTELGQLRTQKIAGGSASKLTKIHDIRKSIAKVLTVINANQRAQLRLFYKGKKYTPLDLRPKQTRAIRRRLTKNESGKTLEKTKKRSVHFPQRKYAIKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.62
4 0.58
5 0.52
6 0.48
7 0.46
8 0.43
9 0.41
10 0.38
11 0.41
12 0.38
13 0.36
14 0.32
15 0.26
16 0.21
17 0.22
18 0.2
19 0.16
20 0.19
21 0.2
22 0.23
23 0.22
24 0.21
25 0.19
26 0.18
27 0.18
28 0.15
29 0.15
30 0.12
31 0.15
32 0.16
33 0.15
34 0.15
35 0.15
36 0.21
37 0.23
38 0.31
39 0.32
40 0.35
41 0.37
42 0.44
43 0.44
44 0.39
45 0.36
46 0.29
47 0.25
48 0.22
49 0.22
50 0.16
51 0.15
52 0.16
53 0.18
54 0.17
55 0.19
56 0.19
57 0.17
58 0.17
59 0.21
60 0.18
61 0.23
62 0.28
63 0.28
64 0.35
65 0.4
66 0.41
67 0.44
68 0.46
69 0.47
70 0.51
71 0.57
72 0.61
73 0.61
74 0.67
75 0.66
76 0.65
77 0.64
78 0.62
79 0.63
80 0.61
81 0.66
82 0.66
83 0.69
84 0.77
85 0.79
86 0.8
87 0.79
88 0.81
89 0.76
90 0.72
91 0.68
92 0.63
93 0.59
94 0.61
95 0.6
96 0.57
97 0.59
98 0.64
99 0.66
100 0.67
101 0.72
102 0.73
103 0.76
104 0.79
105 0.79
106 0.79
107 0.81
108 0.83
109 0.78