Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3D4F3

Protein Details
Accession S3D4F3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-29PAAAGKAKAKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-23GKAKAKKKWSKGKVKDK
Subcellular Location(s) cyto 12.5, cyto_nucl 10, mito 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG glz:GLAREA_06319  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKAKAKKKWSKGKVKDKAQHAVILDKAISDKLAKDVQSYRLVTVAVLVDRLKINGSLARKCLADLEEKGVIKKVVSHSKLNIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.82
4 0.85
5 0.9
6 0.91
7 0.91
8 0.89
9 0.84
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.38
16 0.31
17 0.24
18 0.17
19 0.15
20 0.11
21 0.1
22 0.08
23 0.07
24 0.09
25 0.12
26 0.12
27 0.14
28 0.17
29 0.21
30 0.25
31 0.26
32 0.22
33 0.21
34 0.2
35 0.17
36 0.16
37 0.12
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.17
51 0.19
52 0.18
53 0.18
54 0.2
55 0.17
56 0.19
57 0.18
58 0.21
59 0.24
60 0.24
61 0.25
62 0.25
63 0.24
64 0.19
65 0.22
66 0.25
67 0.31
68 0.34
69 0.38
70 0.4
71 0.49
72 0.56
73 0.54
74 0.51
75 0.44
76 0.43
77 0.39