Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E473

Protein Details
Accession B0E473   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-148KAKKMRLKLMKKRKAFVLREBasic
NLS Segment(s)
PositionSequence
129-142KAKKMRLKLMKKRK
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025340  DUF4246  
KEGG lbc:LACBIDRAFT_303402  -  
Pfam View protein in Pfam  
PF14033  DUF4246  
Amino Acid Sequences MRGQIVYRQEQHEWFPNVFGLEQYGPTFQNVGGVDMREGQLLTFPNILQHQVQPFELEDRTKPGHRKILALFLVNPNIKIISSANVPCQRKDWWREEIGCQGGIDVWLPRELGDLVFEEVEGFPIGMEKAKKMRLKLMKKRKAFVLRETKVFEEETFSLCEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.32
4 0.3
5 0.27
6 0.22
7 0.17
8 0.14
9 0.15
10 0.15
11 0.15
12 0.14
13 0.15
14 0.15
15 0.11
16 0.15
17 0.14
18 0.15
19 0.15
20 0.15
21 0.15
22 0.16
23 0.16
24 0.11
25 0.11
26 0.08
27 0.1
28 0.11
29 0.12
30 0.11
31 0.11
32 0.13
33 0.14
34 0.16
35 0.14
36 0.16
37 0.16
38 0.17
39 0.17
40 0.16
41 0.16
42 0.16
43 0.16
44 0.15
45 0.13
46 0.16
47 0.19
48 0.23
49 0.26
50 0.28
51 0.35
52 0.35
53 0.38
54 0.35
55 0.4
56 0.37
57 0.34
58 0.3
59 0.24
60 0.28
61 0.24
62 0.23
63 0.15
64 0.13
65 0.12
66 0.11
67 0.1
68 0.07
69 0.09
70 0.1
71 0.16
72 0.22
73 0.23
74 0.23
75 0.25
76 0.27
77 0.31
78 0.36
79 0.35
80 0.34
81 0.37
82 0.39
83 0.39
84 0.41
85 0.36
86 0.31
87 0.25
88 0.2
89 0.16
90 0.14
91 0.12
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.08
104 0.08
105 0.08
106 0.07
107 0.08
108 0.07
109 0.06
110 0.05
111 0.06
112 0.06
113 0.09
114 0.09
115 0.12
116 0.17
117 0.24
118 0.28
119 0.3
120 0.4
121 0.47
122 0.57
123 0.65
124 0.72
125 0.74
126 0.77
127 0.8
128 0.8
129 0.8
130 0.74
131 0.74
132 0.74
133 0.68
134 0.68
135 0.67
136 0.59
137 0.51
138 0.48
139 0.37
140 0.32
141 0.29
142 0.25