Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3DLJ4

Protein Details
Accession S3DLJ4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-62LTCYCCCQRRIWRFRARRIARNHydrophilic
NLS Segment(s)
PositionSequence
55-99RARRIARNTQPEPENPLKPKAKRDWRFWVKSERKSRGLGPRIHGR
Subcellular Location(s) mito 12, cyto 7, mito_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_04209  -  
Amino Acid Sequences MALLHPRYIPPSTAINAAKLTTKTILILTFLVLLSVILGVLTCYCCCQRRIWRFRARRIARNTQPEPENPLKPKAKRDWRFWVKSERKSRGLGPRIHGRNARFYAPGLGRERLVVHEEEMRRIRAMERERVDVEEVRRPGKVFERWKWERGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.27
5 0.28
6 0.24
7 0.25
8 0.19
9 0.19
10 0.17
11 0.17
12 0.17
13 0.14
14 0.14
15 0.11
16 0.11
17 0.1
18 0.09
19 0.07
20 0.07
21 0.05
22 0.05
23 0.04
24 0.02
25 0.03
26 0.03
27 0.03
28 0.05
29 0.05
30 0.07
31 0.1
32 0.12
33 0.14
34 0.21
35 0.31
36 0.41
37 0.5
38 0.58
39 0.66
40 0.72
41 0.8
42 0.84
43 0.8
44 0.78
45 0.77
46 0.78
47 0.74
48 0.76
49 0.68
50 0.63
51 0.59
52 0.51
53 0.5
54 0.45
55 0.42
56 0.35
57 0.4
58 0.41
59 0.41
60 0.47
61 0.49
62 0.56
63 0.57
64 0.61
65 0.65
66 0.68
67 0.7
68 0.66
69 0.68
70 0.65
71 0.68
72 0.71
73 0.66
74 0.6
75 0.58
76 0.61
77 0.6
78 0.59
79 0.54
80 0.49
81 0.53
82 0.52
83 0.55
84 0.53
85 0.45
86 0.46
87 0.44
88 0.41
89 0.32
90 0.3
91 0.32
92 0.29
93 0.33
94 0.29
95 0.27
96 0.25
97 0.25
98 0.25
99 0.21
100 0.22
101 0.16
102 0.14
103 0.2
104 0.21
105 0.26
106 0.28
107 0.28
108 0.25
109 0.26
110 0.26
111 0.28
112 0.33
113 0.36
114 0.37
115 0.4
116 0.41
117 0.43
118 0.44
119 0.4
120 0.38
121 0.37
122 0.36
123 0.33
124 0.33
125 0.32
126 0.33
127 0.36
128 0.42
129 0.43
130 0.48
131 0.57
132 0.61