Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DW78

Protein Details
Accession B0DW78    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-84ATKHPDPKFKKLYRRKADKIRKSTGBasic
NLS Segment(s)
PositionSequence
67-81KFKKLYRRKADKIRK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 3, plas 3
Family & Domain DBs
KEGG lbc:LACBIDRAFT_333533  -  
Amino Acid Sequences MTDKKLDPPAYPYGVEVEWNEALQRLEKQMVVYRQAKMRGTEKEIGGAAEDVALAMEDVATKHPDPKFKKLYRRKADKIRKSTGDNRDAVVEDIGKGLLVLLTTPFALAGAILGGVGQVLGGVGSMLREWGKVVNRPRELVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.21
4 0.19
5 0.17
6 0.16
7 0.16
8 0.14
9 0.14
10 0.15
11 0.16
12 0.14
13 0.15
14 0.16
15 0.18
16 0.23
17 0.26
18 0.31
19 0.32
20 0.33
21 0.36
22 0.4
23 0.4
24 0.37
25 0.39
26 0.37
27 0.4
28 0.41
29 0.37
30 0.34
31 0.32
32 0.28
33 0.23
34 0.18
35 0.12
36 0.07
37 0.07
38 0.04
39 0.04
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02
45 0.03
46 0.04
47 0.06
48 0.06
49 0.11
50 0.14
51 0.22
52 0.27
53 0.35
54 0.44
55 0.48
56 0.59
57 0.65
58 0.74
59 0.76
60 0.81
61 0.8
62 0.82
63 0.86
64 0.85
65 0.83
66 0.79
67 0.73
68 0.7
69 0.71
70 0.68
71 0.64
72 0.55
73 0.48
74 0.42
75 0.38
76 0.32
77 0.24
78 0.16
79 0.09
80 0.09
81 0.08
82 0.06
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.05
114 0.05
115 0.06
116 0.07
117 0.12
118 0.18
119 0.25
120 0.35
121 0.43
122 0.47