Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3E447

Protein Details
Accession S3E447   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MPSNSKKNRANKASKESTPKPRIKKPQPPPKTYPSESHydrophilic
92-111AAIAAAKKRRKKNKIGAGIPHydrophilic
NLS Segment(s)
PositionSequence
6-29KKNRANKASKESTPKPRIKKPQPP
97-106AKKRRKKNKI
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
KEGG glz:GLAREA_06220  -  
Amino Acid Sequences MPSNSKKNRANKASKESTPKPRIKKPQPPPKTYPSESEFWQSQLATETKEQEAARMAADLEVFRRVEFNAALAELEEEEKNGKFRYIVAAEAAIAAAKKRRKKNKIGAGIPLLICSWRGRWRKEKFDEPVIEHTALKRNFGVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.79
4 0.8
5 0.8
6 0.79
7 0.77
8 0.79
9 0.83
10 0.84
11 0.87
12 0.87
13 0.88
14 0.89
15 0.89
16 0.85
17 0.83
18 0.81
19 0.73
20 0.69
21 0.62
22 0.54
23 0.48
24 0.46
25 0.38
26 0.3
27 0.29
28 0.22
29 0.18
30 0.19
31 0.18
32 0.15
33 0.16
34 0.17
35 0.16
36 0.2
37 0.19
38 0.17
39 0.18
40 0.16
41 0.15
42 0.13
43 0.12
44 0.08
45 0.09
46 0.08
47 0.06
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.08
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.04
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.07
71 0.08
72 0.13
73 0.13
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.06
81 0.05
82 0.05
83 0.1
84 0.15
85 0.23
86 0.33
87 0.44
88 0.52
89 0.63
90 0.73
91 0.78
92 0.83
93 0.8
94 0.77
95 0.7
96 0.66
97 0.55
98 0.45
99 0.35
100 0.24
101 0.21
102 0.16
103 0.16
104 0.21
105 0.28
106 0.35
107 0.45
108 0.54
109 0.64
110 0.71
111 0.76
112 0.74
113 0.77
114 0.76
115 0.7
116 0.68
117 0.62
118 0.56
119 0.47
120 0.43
121 0.42
122 0.37
123 0.35