Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CVV1

Protein Details
Accession B0CVV1    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26TMNQAMKRKPRAKKQVKSKSPLLENCHydrophilic
NLS Segment(s)
PositionSequence
7-20KRKPRAKKQVKSKS
37-55IIAKPKKPNSAKRKVARVK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_169220  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences TMNQAMKRKPRAKKQVKSKSPLLENCPERKGVVTRLIIAKPKKPNSAKRKVARVKLSTGKSLMAYIQGEGHNLQEHSVVLVRGGRTKDLPGVGYKLVRGALDFGGVVNRAMSRSRYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.88
5 0.85
6 0.82
7 0.8
8 0.76
9 0.71
10 0.69
11 0.66
12 0.64
13 0.58
14 0.5
15 0.42
16 0.39
17 0.35
18 0.31
19 0.32
20 0.27
21 0.29
22 0.32
23 0.34
24 0.37
25 0.37
26 0.39
27 0.41
28 0.45
29 0.51
30 0.54
31 0.62
32 0.66
33 0.74
34 0.76
35 0.74
36 0.8
37 0.78
38 0.78
39 0.76
40 0.68
41 0.64
42 0.62
43 0.57
44 0.48
45 0.42
46 0.34
47 0.27
48 0.24
49 0.18
50 0.12
51 0.1
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.08
62 0.08
63 0.08
64 0.09
65 0.08
66 0.07
67 0.09
68 0.1
69 0.13
70 0.14
71 0.15
72 0.15
73 0.17
74 0.19
75 0.19
76 0.19
77 0.18
78 0.2
79 0.2
80 0.2
81 0.19
82 0.18
83 0.17
84 0.16
85 0.14
86 0.13
87 0.11
88 0.11
89 0.11
90 0.1
91 0.11
92 0.11
93 0.11
94 0.09
95 0.09
96 0.1
97 0.13