Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S3CWK3

Protein Details
Accession S3CWK3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-143EEWFATRLKRQRDREKREERRKEQEKFHREWBasic
NLS Segment(s)
PositionSequence
120-137LKRQRDREKREERRKEQE
Subcellular Location(s) nucl 9, cyto 7, mito 4, pero 4, extr 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG glz:GLAREA_03714  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MAPSTAAAVPEPETEIPRLPMPSRNPLPLSSSQEAQVRELYHARVRGYCAAEIKGRAWCGATLDSFSNIQPVFADCALGRTFTAPFKCRAQNRLMNACMVQHANQTEQDAAREEWFATRLKRQRDREKREERRKEQEKFHREWWGLPIEDREGEKGNEVLRRAERVGGFPKRDDKEGTLSKDRHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.21
5 0.24
6 0.23
7 0.29
8 0.32
9 0.4
10 0.42
11 0.46
12 0.45
13 0.43
14 0.47
15 0.46
16 0.49
17 0.42
18 0.39
19 0.36
20 0.38
21 0.38
22 0.34
23 0.3
24 0.23
25 0.23
26 0.24
27 0.24
28 0.24
29 0.26
30 0.26
31 0.24
32 0.26
33 0.29
34 0.29
35 0.28
36 0.26
37 0.25
38 0.26
39 0.26
40 0.24
41 0.22
42 0.2
43 0.18
44 0.17
45 0.15
46 0.15
47 0.15
48 0.14
49 0.12
50 0.12
51 0.13
52 0.13
53 0.13
54 0.14
55 0.12
56 0.11
57 0.1
58 0.1
59 0.11
60 0.1
61 0.11
62 0.07
63 0.1
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.11
70 0.15
71 0.14
72 0.17
73 0.21
74 0.27
75 0.29
76 0.32
77 0.36
78 0.37
79 0.41
80 0.44
81 0.41
82 0.35
83 0.33
84 0.29
85 0.23
86 0.19
87 0.14
88 0.1
89 0.11
90 0.11
91 0.11
92 0.12
93 0.12
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.1
102 0.11
103 0.13
104 0.13
105 0.2
106 0.25
107 0.34
108 0.44
109 0.52
110 0.62
111 0.71
112 0.79
113 0.81
114 0.87
115 0.89
116 0.91
117 0.93
118 0.89
119 0.89
120 0.89
121 0.85
122 0.84
123 0.84
124 0.8
125 0.75
126 0.73
127 0.7
128 0.62
129 0.57
130 0.51
131 0.46
132 0.38
133 0.35
134 0.31
135 0.25
136 0.26
137 0.25
138 0.23
139 0.2
140 0.2
141 0.2
142 0.2
143 0.21
144 0.22
145 0.23
146 0.26
147 0.26
148 0.29
149 0.29
150 0.32
151 0.3
152 0.32
153 0.39
154 0.42
155 0.43
156 0.43
157 0.51
158 0.5
159 0.52
160 0.51
161 0.45
162 0.47
163 0.51
164 0.55
165 0.55