Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CE16

Protein Details
Accession S3CE16    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
4-33NADPAPPPFKKQKREPKPKPPNKAGSEKTFHydrophilic
NLS Segment(s)
PositionSequence
11-28PFKKQKREPKPKPPNKAG
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 10.5
Family & Domain DBs
KEGG glz:GLAREA_08595  -  
Amino Acid Sequences MTTNADPAPPPFKKQKREPKPKPPNKAGSEKTFAGNKTKECAKFDTLLRAVYNMPYEIAACHEIFALTEIANYYGMLRSLSASITGPIVSNKVIGAFLEPLAEDMLPRAVKLRNKALYKECLIYCLGPYNEPRYDSLKDHAKIYLSAEKVYQRLSVKVSQRLQDILENVAREFSPEWEEDQLKKLIKAIVKSRVIAPEDDASIPEFFRNLEGQNDFYDCGCCHDLLDNQLVFNIDAVAGKGGFREYFLVADLEEEDYPWDTKEMDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.77
4 0.86
5 0.91
6 0.92
7 0.94
8 0.95
9 0.95
10 0.93
11 0.92
12 0.88
13 0.87
14 0.83
15 0.79
16 0.75
17 0.66
18 0.6
19 0.54
20 0.49
21 0.47
22 0.45
23 0.39
24 0.38
25 0.44
26 0.44
27 0.43
28 0.47
29 0.43
30 0.43
31 0.44
32 0.48
33 0.41
34 0.4
35 0.36
36 0.32
37 0.29
38 0.25
39 0.24
40 0.15
41 0.14
42 0.11
43 0.11
44 0.1
45 0.12
46 0.12
47 0.11
48 0.11
49 0.1
50 0.1
51 0.1
52 0.11
53 0.09
54 0.06
55 0.07
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.07
70 0.07
71 0.08
72 0.08
73 0.07
74 0.07
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.05
91 0.05
92 0.08
93 0.07
94 0.07
95 0.09
96 0.13
97 0.16
98 0.2
99 0.28
100 0.32
101 0.34
102 0.39
103 0.41
104 0.42
105 0.41
106 0.41
107 0.33
108 0.27
109 0.26
110 0.22
111 0.18
112 0.17
113 0.15
114 0.13
115 0.15
116 0.17
117 0.18
118 0.18
119 0.2
120 0.2
121 0.22
122 0.22
123 0.25
124 0.29
125 0.28
126 0.28
127 0.28
128 0.24
129 0.22
130 0.24
131 0.25
132 0.17
133 0.17
134 0.18
135 0.18
136 0.18
137 0.19
138 0.19
139 0.15
140 0.16
141 0.19
142 0.24
143 0.27
144 0.34
145 0.36
146 0.34
147 0.34
148 0.34
149 0.32
150 0.28
151 0.24
152 0.19
153 0.18
154 0.16
155 0.14
156 0.14
157 0.13
158 0.11
159 0.11
160 0.1
161 0.11
162 0.11
163 0.13
164 0.16
165 0.18
166 0.18
167 0.21
168 0.23
169 0.22
170 0.21
171 0.22
172 0.23
173 0.23
174 0.27
175 0.3
176 0.35
177 0.37
178 0.38
179 0.38
180 0.39
181 0.38
182 0.34
183 0.3
184 0.23
185 0.23
186 0.22
187 0.19
188 0.16
189 0.14
190 0.14
191 0.11
192 0.09
193 0.08
194 0.1
195 0.11
196 0.11
197 0.15
198 0.16
199 0.18
200 0.19
201 0.2
202 0.19
203 0.18
204 0.19
205 0.14
206 0.18
207 0.17
208 0.16
209 0.15
210 0.18
211 0.2
212 0.21
213 0.28
214 0.23
215 0.21
216 0.22
217 0.22
218 0.19
219 0.16
220 0.13
221 0.07
222 0.07
223 0.08
224 0.08
225 0.07
226 0.07
227 0.08
228 0.09
229 0.09
230 0.1
231 0.11
232 0.11
233 0.12
234 0.13
235 0.13
236 0.11
237 0.12
238 0.12
239 0.12
240 0.11
241 0.11
242 0.11
243 0.12
244 0.13
245 0.13
246 0.13