Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3E1D3

Protein Details
Accession S3E1D3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
328-349MILARFESKKWKKKIETLGFIEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, cyto_mito 12.833, cyto_nucl 11.333, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003495  CobW/HypB/UreG_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG glz:GLAREA_07411  -  
Pfam View protein in Pfam  
PF02492  cobW  
CDD cd03112  CobW-like  
Amino Acid Sequences MSPIPITIITGFLGSGKTTLLLNLIPQLLSQNPSYKLALVKNEFGDVAIDSQLASSSSISGVRELLNGCICCNLVGQLDTALEELRKTVKPDRIVIETSGSAFPATLAMEVNRLARDTKAYALDGVVTVIDVENWKGYEDTSYTAKIQAKYTDLIVLNKWEIAGERRLDECLDRVGDLEVQVATVKSDKGKVPVDLVFGVDGASARLLGVEGAEKHHHDHANGHEHAKSHQSEVEVLSITLMASSPSSKINNAKLTKLLESAPKDEVYRIKSVFASASPIPAPDSESEIAESERYILNWAFGRWTCTPLKGEENVSSGGEGVILRMTMILARFESKKWKKKIETLGFIELDGDENGSLVVENIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.1
10 0.13
11 0.14
12 0.13
13 0.13
14 0.15
15 0.15
16 0.17
17 0.19
18 0.21
19 0.23
20 0.26
21 0.27
22 0.27
23 0.29
24 0.32
25 0.38
26 0.36
27 0.38
28 0.36
29 0.36
30 0.33
31 0.29
32 0.25
33 0.17
34 0.14
35 0.11
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.13
51 0.13
52 0.15
53 0.18
54 0.18
55 0.17
56 0.17
57 0.17
58 0.15
59 0.15
60 0.13
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.07
71 0.08
72 0.11
73 0.13
74 0.17
75 0.23
76 0.29
77 0.33
78 0.38
79 0.41
80 0.41
81 0.42
82 0.39
83 0.34
84 0.28
85 0.26
86 0.21
87 0.17
88 0.13
89 0.11
90 0.1
91 0.08
92 0.07
93 0.05
94 0.06
95 0.06
96 0.07
97 0.08
98 0.1
99 0.09
100 0.1
101 0.1
102 0.1
103 0.12
104 0.13
105 0.15
106 0.15
107 0.15
108 0.15
109 0.14
110 0.14
111 0.11
112 0.1
113 0.07
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.1
128 0.11
129 0.12
130 0.12
131 0.17
132 0.21
133 0.21
134 0.22
135 0.22
136 0.22
137 0.21
138 0.21
139 0.21
140 0.19
141 0.18
142 0.17
143 0.16
144 0.14
145 0.13
146 0.13
147 0.08
148 0.08
149 0.09
150 0.12
151 0.12
152 0.13
153 0.13
154 0.14
155 0.14
156 0.14
157 0.12
158 0.11
159 0.1
160 0.08
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.06
167 0.05
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.09
175 0.09
176 0.13
177 0.15
178 0.16
179 0.17
180 0.18
181 0.19
182 0.17
183 0.16
184 0.12
185 0.1
186 0.09
187 0.07
188 0.05
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.05
199 0.07
200 0.08
201 0.09
202 0.11
203 0.16
204 0.17
205 0.16
206 0.19
207 0.23
208 0.3
209 0.31
210 0.3
211 0.27
212 0.27
213 0.28
214 0.3
215 0.25
216 0.18
217 0.19
218 0.18
219 0.18
220 0.18
221 0.19
222 0.14
223 0.13
224 0.11
225 0.09
226 0.08
227 0.06
228 0.05
229 0.04
230 0.04
231 0.05
232 0.06
233 0.09
234 0.1
235 0.13
236 0.17
237 0.24
238 0.32
239 0.33
240 0.34
241 0.35
242 0.37
243 0.36
244 0.33
245 0.29
246 0.27
247 0.28
248 0.29
249 0.27
250 0.26
251 0.25
252 0.26
253 0.29
254 0.26
255 0.28
256 0.26
257 0.25
258 0.24
259 0.25
260 0.23
261 0.19
262 0.2
263 0.15
264 0.17
265 0.16
266 0.16
267 0.16
268 0.15
269 0.16
270 0.12
271 0.17
272 0.15
273 0.15
274 0.16
275 0.16
276 0.16
277 0.14
278 0.13
279 0.1
280 0.1
281 0.09
282 0.11
283 0.1
284 0.13
285 0.14
286 0.15
287 0.18
288 0.17
289 0.23
290 0.21
291 0.26
292 0.25
293 0.27
294 0.29
295 0.29
296 0.34
297 0.31
298 0.34
299 0.32
300 0.33
301 0.31
302 0.29
303 0.25
304 0.2
305 0.16
306 0.13
307 0.1
308 0.08
309 0.07
310 0.06
311 0.06
312 0.06
313 0.06
314 0.07
315 0.08
316 0.09
317 0.1
318 0.14
319 0.15
320 0.18
321 0.29
322 0.38
323 0.47
324 0.54
325 0.64
326 0.68
327 0.76
328 0.85
329 0.84
330 0.83
331 0.8
332 0.78
333 0.68
334 0.6
335 0.51
336 0.4
337 0.31
338 0.22
339 0.16
340 0.08
341 0.08
342 0.08
343 0.07
344 0.07