Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S3CXY6

Protein Details
Accession S3CXY6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
200-248WVVWGWRGRPRWRRDRRAWSGRRTWRDRSRSWSAPPRDRKRRGVEAWSGHydrophilic
NLS Segment(s)
PositionSequence
143-242RGIRYPERTWRRGRDESWEGRSGRGSDGRSRRGSERGVGIEGWTRPRQRGRRGRVFDWVVWGWRGRPRWRRDRRAWSGRRTWRDRSRSWSAPPRDRKRRG
Subcellular Location(s) nucl 7, plas 6, mito_nucl 6, mito 5, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG glz:GLAREA_00944  -  
Amino Acid Sequences MAPPQPQPRQHRQAEPTQRIVTLTITRDSTVYTTIIPLGSSPTTIPIQQSPISVPTSPTTTPTAALITPVGESSNRGTVAGAVIGSVVGFLFLFWFLWKCRPYYRFWDTRDTISYSSYDSESYYSPGPPPMRQRGGGGEWGGRGIRYPERTWRRGRDESWEGRSGRGSDGRSRRGSERGVGIEGWTRPRQRGRRGRVFDWVVWGWRGRPRWRRDRRAWSGRRTWRDRSRSWSAPPRDRKRRGVEAWSGMKYKPGTVDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.75
4 0.67
5 0.61
6 0.52
7 0.47
8 0.4
9 0.35
10 0.3
11 0.26
12 0.25
13 0.25
14 0.24
15 0.24
16 0.21
17 0.17
18 0.15
19 0.12
20 0.12
21 0.13
22 0.13
23 0.11
24 0.1
25 0.12
26 0.11
27 0.11
28 0.11
29 0.13
30 0.14
31 0.15
32 0.17
33 0.16
34 0.2
35 0.2
36 0.21
37 0.19
38 0.21
39 0.23
40 0.21
41 0.21
42 0.18
43 0.21
44 0.2
45 0.21
46 0.21
47 0.2
48 0.2
49 0.19
50 0.18
51 0.14
52 0.15
53 0.12
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.08
60 0.09
61 0.13
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.11
68 0.09
69 0.05
70 0.05
71 0.04
72 0.04
73 0.03
74 0.03
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.06
84 0.12
85 0.13
86 0.15
87 0.22
88 0.24
89 0.28
90 0.36
91 0.42
92 0.44
93 0.46
94 0.53
95 0.48
96 0.49
97 0.47
98 0.41
99 0.35
100 0.28
101 0.25
102 0.17
103 0.17
104 0.14
105 0.11
106 0.09
107 0.1
108 0.09
109 0.1
110 0.1
111 0.09
112 0.09
113 0.14
114 0.15
115 0.17
116 0.22
117 0.27
118 0.29
119 0.29
120 0.3
121 0.29
122 0.29
123 0.28
124 0.23
125 0.17
126 0.15
127 0.15
128 0.13
129 0.1
130 0.08
131 0.09
132 0.12
133 0.15
134 0.16
135 0.26
136 0.33
137 0.39
138 0.45
139 0.51
140 0.55
141 0.57
142 0.57
143 0.55
144 0.56
145 0.57
146 0.55
147 0.53
148 0.45
149 0.41
150 0.41
151 0.34
152 0.28
153 0.27
154 0.24
155 0.27
156 0.33
157 0.39
158 0.4
159 0.42
160 0.42
161 0.42
162 0.42
163 0.37
164 0.34
165 0.29
166 0.28
167 0.25
168 0.23
169 0.22
170 0.22
171 0.24
172 0.24
173 0.24
174 0.27
175 0.37
176 0.44
177 0.51
178 0.6
179 0.65
180 0.71
181 0.76
182 0.74
183 0.74
184 0.71
185 0.61
186 0.57
187 0.48
188 0.39
189 0.34
190 0.32
191 0.26
192 0.27
193 0.33
194 0.36
195 0.44
196 0.52
197 0.62
198 0.72
199 0.79
200 0.84
201 0.88
202 0.89
203 0.91
204 0.9
205 0.89
206 0.88
207 0.88
208 0.88
209 0.83
210 0.83
211 0.82
212 0.81
213 0.78
214 0.76
215 0.75
216 0.71
217 0.74
218 0.74
219 0.73
220 0.75
221 0.8
222 0.83
223 0.85
224 0.87
225 0.87
226 0.86
227 0.86
228 0.83
229 0.81
230 0.78
231 0.76
232 0.75
233 0.7
234 0.64
235 0.53
236 0.52
237 0.44
238 0.38