Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PFF4

Protein Details
Accession A0A1D8PFF4   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
185-212INKIEDARDKERKKKEVKKVVRSINLKLHydrophilic
NLS Segment(s)
PositionSequence
194-203KERKKKEVKK
Subcellular Location(s) nucl 14, cyto_nucl 10.333, cyto 4.5, cyto_mito 4.166, plas 3, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0012505  C:endomembrane system  
GO:0005789  C:endoplasmic reticulum membrane  
GO:1990871  C:Vma12-Vma22 assembly complex  
GO:0007035  P:vacuolar acidification  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG cal:CAALFM_C112260WA  -  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MTSFKLTPTLKETINASSLTKDQKQKLLSHSHLTHADLIKFYQTCHPTSTLLQLIQQTKLYIPPYKTYIQPKTSEFIKTMEKLRLEAKEQEYRRLINPTPQYSTLYDKKLEDYDLAPTPQQASKELKNQLTTIINVFISVGSVSYAIWYWTETSWGLPVSYRALLSVFFGLLVLVAEVVVYMGYINKIEDARDKERKKKEVKKVVRSINLKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.22
5 0.25
6 0.29
7 0.34
8 0.38
9 0.4
10 0.46
11 0.49
12 0.51
13 0.54
14 0.58
15 0.55
16 0.56
17 0.54
18 0.52
19 0.5
20 0.46
21 0.45
22 0.38
23 0.35
24 0.27
25 0.26
26 0.25
27 0.23
28 0.23
29 0.25
30 0.24
31 0.24
32 0.26
33 0.28
34 0.25
35 0.26
36 0.3
37 0.25
38 0.23
39 0.24
40 0.26
41 0.26
42 0.26
43 0.25
44 0.21
45 0.18
46 0.21
47 0.22
48 0.22
49 0.22
50 0.23
51 0.27
52 0.28
53 0.33
54 0.38
55 0.42
56 0.42
57 0.43
58 0.42
59 0.41
60 0.41
61 0.38
62 0.3
63 0.25
64 0.25
65 0.25
66 0.26
67 0.28
68 0.26
69 0.25
70 0.27
71 0.27
72 0.26
73 0.29
74 0.3
75 0.34
76 0.34
77 0.39
78 0.37
79 0.36
80 0.35
81 0.34
82 0.3
83 0.29
84 0.34
85 0.31
86 0.32
87 0.32
88 0.32
89 0.29
90 0.34
91 0.31
92 0.27
93 0.26
94 0.23
95 0.24
96 0.22
97 0.21
98 0.16
99 0.13
100 0.14
101 0.14
102 0.14
103 0.13
104 0.12
105 0.13
106 0.14
107 0.14
108 0.14
109 0.16
110 0.19
111 0.26
112 0.31
113 0.32
114 0.32
115 0.31
116 0.31
117 0.29
118 0.26
119 0.2
120 0.16
121 0.14
122 0.12
123 0.12
124 0.08
125 0.07
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.08
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.09
145 0.1
146 0.11
147 0.12
148 0.12
149 0.11
150 0.1
151 0.11
152 0.12
153 0.11
154 0.08
155 0.07
156 0.07
157 0.06
158 0.06
159 0.05
160 0.04
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.02
167 0.02
168 0.02
169 0.03
170 0.04
171 0.05
172 0.05
173 0.08
174 0.09
175 0.1
176 0.17
177 0.24
178 0.32
179 0.42
180 0.49
181 0.57
182 0.66
183 0.75
184 0.78
185 0.82
186 0.84
187 0.85
188 0.89
189 0.9
190 0.91
191 0.91
192 0.9
193 0.84