Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DTF7

Protein Details
Accession B0DTF7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
125-153ALKPMMLTKKEQKKMRKLRRKEALQDKRDBasic
NLS Segment(s)
PositionSequence
128-148PMMLTKKEQKKMRKLRRKEAL
Subcellular Location(s) cyto_nucl 11.5, nucl 10, cyto 7, cysk 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013881  Pre-mRNA_splic_Prp3_dom  
IPR027104  Prp3  
Gene Ontology GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG lbc:LACBIDRAFT_310000  -  
Pfam View protein in Pfam  
PF08572  PRP3  
Amino Acid Sequences MGREPPDSMACLEKEVVDCSVSIQYVAFANQQRQEAQLEALKQCIAESARKAGLDGNMGIEKTIKHAAPPDAEWLDAALLPTKSYDDIEMFVFEQLNIRTSDSPITIYIQHPIPIPAPGEKNKIALKPMMLTKKEQKKMRKLRRKEALQDKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.14
5 0.13
6 0.13
7 0.15
8 0.13
9 0.11
10 0.1
11 0.09
12 0.1
13 0.11
14 0.14
15 0.15
16 0.19
17 0.22
18 0.24
19 0.23
20 0.24
21 0.25
22 0.21
23 0.21
24 0.2
25 0.2
26 0.18
27 0.19
28 0.17
29 0.15
30 0.14
31 0.14
32 0.13
33 0.14
34 0.15
35 0.18
36 0.19
37 0.19
38 0.2
39 0.18
40 0.18
41 0.16
42 0.15
43 0.13
44 0.12
45 0.12
46 0.12
47 0.1
48 0.09
49 0.1
50 0.13
51 0.1
52 0.1
53 0.14
54 0.16
55 0.17
56 0.17
57 0.19
58 0.16
59 0.16
60 0.15
61 0.12
62 0.1
63 0.09
64 0.08
65 0.06
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.06
74 0.07
75 0.08
76 0.09
77 0.09
78 0.08
79 0.08
80 0.07
81 0.09
82 0.08
83 0.09
84 0.09
85 0.11
86 0.11
87 0.12
88 0.14
89 0.12
90 0.13
91 0.12
92 0.13
93 0.13
94 0.13
95 0.15
96 0.15
97 0.16
98 0.15
99 0.16
100 0.15
101 0.15
102 0.16
103 0.17
104 0.21
105 0.23
106 0.28
107 0.28
108 0.32
109 0.34
110 0.35
111 0.34
112 0.31
113 0.29
114 0.28
115 0.34
116 0.38
117 0.36
118 0.4
119 0.48
120 0.56
121 0.63
122 0.66
123 0.69
124 0.71
125 0.81
126 0.86
127 0.87
128 0.87
129 0.89
130 0.92
131 0.92
132 0.91
133 0.91