Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1W4U1

Protein Details
Accession M1W4U1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-183EQLQQQKQRQHQRQQRQQHQQHHQQNPPPQQKPQQQKKKQQQRGQQQQQHQPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035186  DUF5308  
Pfam View protein in Pfam  
PF17233  DUF5308  
Amino Acid Sequences MAQLPSEFPTLAIHLADKNRDPIITSSSSPSQLASLTSIAAGALVSHSAIQRIGLGRPERIMVEYPDAGAVIIETFLDTPESVAPAVAAGSAIVPGKGSGASSSQPQPPPPQQQQQQHQQHQHQQLQLQQEEQLQQQKQRQHQRQQRQQHQQHHQQNPPPQQKPQQQKKKQQQRGQQQQQHQPQLEQPQSQPQMQHPLQQQQQRQQTQLQRHRQLQLQQQAPPPLKEAHSDAPPLMAGFVIAASPRDLSRASEALVRVEMLGKRLQEEWVEEVKRDPGFAREVDSEVMNLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.26
4 0.26
5 0.28
6 0.28
7 0.28
8 0.29
9 0.27
10 0.29
11 0.27
12 0.27
13 0.28
14 0.3
15 0.31
16 0.29
17 0.27
18 0.22
19 0.19
20 0.18
21 0.15
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.08
28 0.06
29 0.04
30 0.04
31 0.04
32 0.04
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.1
39 0.11
40 0.13
41 0.18
42 0.2
43 0.21
44 0.22
45 0.23
46 0.21
47 0.21
48 0.22
49 0.17
50 0.2
51 0.19
52 0.18
53 0.17
54 0.16
55 0.13
56 0.11
57 0.09
58 0.04
59 0.04
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.07
89 0.1
90 0.14
91 0.19
92 0.2
93 0.22
94 0.27
95 0.32
96 0.4
97 0.43
98 0.49
99 0.51
100 0.58
101 0.63
102 0.68
103 0.71
104 0.7
105 0.71
106 0.68
107 0.68
108 0.68
109 0.65
110 0.57
111 0.49
112 0.46
113 0.44
114 0.39
115 0.31
116 0.24
117 0.21
118 0.21
119 0.21
120 0.23
121 0.19
122 0.23
123 0.27
124 0.31
125 0.37
126 0.46
127 0.53
128 0.57
129 0.65
130 0.72
131 0.77
132 0.82
133 0.84
134 0.84
135 0.84
136 0.83
137 0.82
138 0.82
139 0.82
140 0.79
141 0.74
142 0.69
143 0.68
144 0.69
145 0.69
146 0.61
147 0.56
148 0.57
149 0.6
150 0.65
151 0.69
152 0.7
153 0.71
154 0.79
155 0.86
156 0.88
157 0.9
158 0.87
159 0.85
160 0.85
161 0.87
162 0.87
163 0.83
164 0.8
165 0.8
166 0.8
167 0.77
168 0.67
169 0.56
170 0.5
171 0.51
172 0.46
173 0.39
174 0.32
175 0.34
176 0.36
177 0.36
178 0.34
179 0.28
180 0.34
181 0.32
182 0.38
183 0.33
184 0.38
185 0.42
186 0.47
187 0.5
188 0.49
189 0.58
190 0.54
191 0.53
192 0.53
193 0.54
194 0.58
195 0.63
196 0.65
197 0.63
198 0.65
199 0.67
200 0.64
201 0.64
202 0.63
203 0.61
204 0.56
205 0.53
206 0.53
207 0.56
208 0.53
209 0.47
210 0.41
211 0.35
212 0.32
213 0.3
214 0.3
215 0.28
216 0.28
217 0.29
218 0.25
219 0.24
220 0.22
221 0.2
222 0.15
223 0.09
224 0.06
225 0.05
226 0.05
227 0.04
228 0.04
229 0.05
230 0.06
231 0.07
232 0.07
233 0.09
234 0.1
235 0.12
236 0.17
237 0.17
238 0.18
239 0.21
240 0.22
241 0.22
242 0.22
243 0.19
244 0.15
245 0.18
246 0.18
247 0.16
248 0.19
249 0.18
250 0.19
251 0.2
252 0.22
253 0.19
254 0.21
255 0.25
256 0.3
257 0.31
258 0.29
259 0.3
260 0.33
261 0.31
262 0.3
263 0.25
264 0.21
265 0.24
266 0.24
267 0.27
268 0.24
269 0.26
270 0.26
271 0.26