Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1WGN8

Protein Details
Accession M1WGN8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-45ALDFLKPKPKRGPKKLRLVDRPYTAHydrophilic
NLS Segment(s)
PositionSequence
26-37KPKPKRGPKKLR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.333, cyto_mito 7.333, cyto 7, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR006600  HTH_CenpB_DNA-bd_dom  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MPPLGEIDLNVVQRTPTTVTALDFLKPKPKRGPKKLRLVDRPYTAPKPITRIERSYSPHTRDSVLMFLIHHRIYDPGHRKSIGGYRSPSQDEASKMFQIPMLTMTTWWRKRDEEKFKKAVDRIISWPLFEKELYARFLEARRLNKPITTGWFRRVSREIFRELYPSHVGVFTFSNGWYIGFKMRNSIFPTLHPPYDVPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.16
5 0.17
6 0.18
7 0.21
8 0.22
9 0.22
10 0.22
11 0.22
12 0.29
13 0.3
14 0.36
15 0.43
16 0.53
17 0.61
18 0.7
19 0.8
20 0.79
21 0.88
22 0.9
23 0.9
24 0.89
25 0.86
26 0.82
27 0.76
28 0.73
29 0.68
30 0.63
31 0.56
32 0.5
33 0.44
34 0.42
35 0.42
36 0.44
37 0.42
38 0.43
39 0.44
40 0.46
41 0.49
42 0.53
43 0.55
44 0.51
45 0.5
46 0.47
47 0.45
48 0.39
49 0.35
50 0.29
51 0.22
52 0.17
53 0.14
54 0.14
55 0.16
56 0.14
57 0.12
58 0.11
59 0.11
60 0.12
61 0.21
62 0.27
63 0.27
64 0.3
65 0.31
66 0.31
67 0.32
68 0.37
69 0.31
70 0.28
71 0.27
72 0.26
73 0.29
74 0.31
75 0.29
76 0.24
77 0.23
78 0.21
79 0.22
80 0.22
81 0.19
82 0.18
83 0.17
84 0.17
85 0.14
86 0.12
87 0.1
88 0.09
89 0.08
90 0.08
91 0.11
92 0.18
93 0.22
94 0.24
95 0.25
96 0.26
97 0.33
98 0.43
99 0.51
100 0.53
101 0.58
102 0.62
103 0.63
104 0.66
105 0.6
106 0.55
107 0.47
108 0.41
109 0.36
110 0.37
111 0.35
112 0.29
113 0.31
114 0.27
115 0.24
116 0.2
117 0.18
118 0.14
119 0.17
120 0.18
121 0.16
122 0.16
123 0.16
124 0.18
125 0.24
126 0.27
127 0.29
128 0.3
129 0.34
130 0.34
131 0.34
132 0.35
133 0.31
134 0.33
135 0.35
136 0.35
137 0.37
138 0.45
139 0.44
140 0.48
141 0.49
142 0.46
143 0.47
144 0.49
145 0.48
146 0.42
147 0.42
148 0.41
149 0.37
150 0.37
151 0.31
152 0.27
153 0.23
154 0.21
155 0.2
156 0.17
157 0.18
158 0.14
159 0.13
160 0.12
161 0.12
162 0.11
163 0.12
164 0.11
165 0.12
166 0.17
167 0.2
168 0.2
169 0.26
170 0.28
171 0.33
172 0.37
173 0.42
174 0.37
175 0.36
176 0.45
177 0.43
178 0.42
179 0.38