Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1WC73

Protein Details
Accession M1WC73    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
291-333DDDPFGVKRRRARRVQSREQMKRGDRGRPGRERERNREMEKDRBasic
NLS Segment(s)
PositionSequence
298-340KRRRARRVQSREQMKRGDRGRPGRERERNREMEKDRSREREKG
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MARKLPWASPRNANTTTTTTSAPATPLPNLLARQISPHGHASHTPQTCPPATGPPRARSSSITPPPEPPPEQFMIPLLDDKYRMVEDELLHTAQQYTTHLHRAEYIRLKAVISSRNAHTIREMERPVVPSSGGSTPRGRAVRVRRKIVEGKQAVLVGEEAPWMGTSLQGLMEKGEKGGEGDRDGKGGGGRDGSLERVVGDGSLERVVGDGSLGHVDGEDGLKMRTVAGCTNGGERERSRTMPSYEGVSGGGSEERSLRRDGEWRIEGRKRVKEEEEGGYEEEQKEEDSDDDDDPFGVKRRRARRVQSREQMKRGDRGRPGRERERNREMEKDRSREREKGRDVMPSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.4
5 0.36
6 0.3
7 0.28
8 0.27
9 0.24
10 0.22
11 0.21
12 0.2
13 0.2
14 0.21
15 0.23
16 0.23
17 0.24
18 0.24
19 0.21
20 0.24
21 0.27
22 0.27
23 0.27
24 0.31
25 0.3
26 0.29
27 0.31
28 0.34
29 0.38
30 0.38
31 0.37
32 0.35
33 0.38
34 0.37
35 0.37
36 0.32
37 0.34
38 0.36
39 0.43
40 0.48
41 0.49
42 0.54
43 0.55
44 0.55
45 0.49
46 0.51
47 0.52
48 0.53
49 0.53
50 0.49
51 0.5
52 0.54
53 0.56
54 0.52
55 0.43
56 0.41
57 0.37
58 0.36
59 0.32
60 0.28
61 0.24
62 0.22
63 0.22
64 0.17
65 0.16
66 0.16
67 0.15
68 0.16
69 0.14
70 0.14
71 0.13
72 0.15
73 0.15
74 0.18
75 0.2
76 0.18
77 0.18
78 0.17
79 0.16
80 0.13
81 0.13
82 0.11
83 0.12
84 0.14
85 0.2
86 0.21
87 0.21
88 0.25
89 0.27
90 0.34
91 0.37
92 0.36
93 0.33
94 0.33
95 0.33
96 0.29
97 0.31
98 0.28
99 0.24
100 0.26
101 0.24
102 0.32
103 0.33
104 0.31
105 0.29
106 0.28
107 0.29
108 0.31
109 0.3
110 0.24
111 0.25
112 0.28
113 0.27
114 0.23
115 0.2
116 0.14
117 0.16
118 0.18
119 0.18
120 0.18
121 0.18
122 0.18
123 0.24
124 0.25
125 0.23
126 0.26
127 0.35
128 0.43
129 0.49
130 0.55
131 0.51
132 0.56
133 0.63
134 0.61
135 0.6
136 0.5
137 0.44
138 0.4
139 0.38
140 0.32
141 0.25
142 0.19
143 0.1
144 0.08
145 0.07
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.06
156 0.06
157 0.06
158 0.07
159 0.07
160 0.07
161 0.07
162 0.06
163 0.06
164 0.08
165 0.08
166 0.09
167 0.12
168 0.11
169 0.12
170 0.12
171 0.11
172 0.1
173 0.1
174 0.09
175 0.07
176 0.07
177 0.08
178 0.08
179 0.09
180 0.08
181 0.07
182 0.07
183 0.06
184 0.06
185 0.05
186 0.05
187 0.04
188 0.05
189 0.05
190 0.05
191 0.04
192 0.05
193 0.05
194 0.04
195 0.04
196 0.03
197 0.03
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.04
206 0.05
207 0.05
208 0.05
209 0.05
210 0.06
211 0.06
212 0.08
213 0.08
214 0.1
215 0.12
216 0.12
217 0.15
218 0.16
219 0.16
220 0.18
221 0.18
222 0.22
223 0.23
224 0.25
225 0.26
226 0.29
227 0.31
228 0.31
229 0.31
230 0.28
231 0.25
232 0.24
233 0.2
234 0.15
235 0.13
236 0.11
237 0.11
238 0.07
239 0.07
240 0.1
241 0.11
242 0.13
243 0.15
244 0.15
245 0.17
246 0.23
247 0.26
248 0.31
249 0.35
250 0.37
251 0.43
252 0.47
253 0.53
254 0.54
255 0.58
256 0.55
257 0.56
258 0.56
259 0.55
260 0.54
261 0.53
262 0.48
263 0.43
264 0.39
265 0.34
266 0.33
267 0.27
268 0.23
269 0.17
270 0.14
271 0.12
272 0.12
273 0.11
274 0.11
275 0.13
276 0.13
277 0.14
278 0.13
279 0.13
280 0.12
281 0.13
282 0.18
283 0.21
284 0.25
285 0.33
286 0.43
287 0.52
288 0.61
289 0.71
290 0.75
291 0.8
292 0.87
293 0.88
294 0.9
295 0.89
296 0.87
297 0.86
298 0.79
299 0.78
300 0.72
301 0.71
302 0.69
303 0.7
304 0.72
305 0.73
306 0.77
307 0.79
308 0.84
309 0.85
310 0.85
311 0.86
312 0.85
313 0.81
314 0.82
315 0.77
316 0.77
317 0.77
318 0.76
319 0.74
320 0.74
321 0.75
322 0.74
323 0.78
324 0.77
325 0.75
326 0.74
327 0.69
328 0.69