Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1W7U2

Protein Details
Accession M1W7U2    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-28LYTRIQSVIRNRSRRQRRQPDVEISAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MLYTRIQSVIRNRSRRQRRQPDVEISAPFGLKREAVNLPGVSQEELSILREKAAASQIGILELRPESPMEYDLYKRARPSPRLRSAVASYASDETRSRVFQDRPLWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.85
4 0.86
5 0.86
6 0.87
7 0.89
8 0.87
9 0.82
10 0.75
11 0.65
12 0.56
13 0.47
14 0.38
15 0.29
16 0.21
17 0.16
18 0.12
19 0.12
20 0.12
21 0.12
22 0.14
23 0.17
24 0.16
25 0.15
26 0.16
27 0.16
28 0.13
29 0.11
30 0.1
31 0.07
32 0.08
33 0.09
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.09
42 0.07
43 0.09
44 0.08
45 0.09
46 0.09
47 0.07
48 0.06
49 0.06
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.09
57 0.11
58 0.12
59 0.17
60 0.21
61 0.22
62 0.23
63 0.3
64 0.37
65 0.43
66 0.52
67 0.57
68 0.63
69 0.66
70 0.66
71 0.63
72 0.59
73 0.57
74 0.49
75 0.39
76 0.32
77 0.3
78 0.29
79 0.25
80 0.22
81 0.19
82 0.2
83 0.2
84 0.22
85 0.27
86 0.29
87 0.35