Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1VZC8

Protein Details
Accession M1VZC8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-122KEKIDKIRERRAKKEERERYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
24-118MRKNGKQWHEPKKAFRPTKGLTTYEKRTKERAAMLQMKAKEKELKDDKEQARKEKIDKIRERRAKKEERERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSGDEAPALVPTSGEEKTLKPLGMRKNGKQWHEPKKAFRPTKGLTTYEKRTKERAAMLQMKAKEKELKDDKEQARKEKIDKIRERRAKKEERERYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.2
5 0.23
6 0.23
7 0.22
8 0.29
9 0.36
10 0.45
11 0.5
12 0.49
13 0.56
14 0.62
15 0.64
16 0.67
17 0.68
18 0.68
19 0.72
20 0.72
21 0.7
22 0.74
23 0.8
24 0.76
25 0.7
26 0.67
27 0.6
28 0.63
29 0.59
30 0.52
31 0.47
32 0.49
33 0.53
34 0.52
35 0.55
36 0.49
37 0.48
38 0.48
39 0.46
40 0.44
41 0.41
42 0.41
43 0.41
44 0.41
45 0.41
46 0.41
47 0.4
48 0.36
49 0.34
50 0.31
51 0.25
52 0.32
53 0.35
54 0.36
55 0.37
56 0.46
57 0.49
58 0.54
59 0.57
60 0.54
61 0.54
62 0.53
63 0.52
64 0.52
65 0.55
66 0.56
67 0.62
68 0.65
69 0.69
70 0.74
71 0.77
72 0.77
73 0.79
74 0.79
75 0.79
76 0.82
77 0.81
78 0.81
79 0.83
80 0.78
81 0.75
82 0.7
83 0.62
84 0.53
85 0.49
86 0.45
87 0.47
88 0.5
89 0.52
90 0.53
91 0.52
92 0.59
93 0.62
94 0.68
95 0.69
96 0.73
97 0.76
98 0.79
99 0.89
100 0.92
101 0.93
102 0.93