Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M1W672

Protein Details
Accession M1W672    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-53AAPTPRRKEPWWRVHLCRGMIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR011531  HCO3_transpt-like_TM_dom  
IPR003020  HCO3_transpt_euk  
Gene Ontology GO:0016020  C:membrane  
GO:0005452  F:solute:inorganic anion antiporter activity  
GO:0006820  P:monoatomic anion transport  
Pfam View protein in Pfam  
PF00955  HCO3_cotransp  
Amino Acid Sequences MSRPTGPALEVAAHDDDRDGRAHDAHDTIDGGAAPTPRRKEPWWRVHLCRGMINDVRRRLPFYTSDWLDAWDYRVVPATVYMYFANILPALAFSLDMFSKTGSNYGVNEVLLASVLGSLVFAFFAAQPLVIVGVTGPITVFNYTVYDIMKDTGVDYISFMAWIGIWSLILHVILAVTNSCNALRWVTRFPCDIFGFYVAFIYLQKGIQVLEHLGYSAPFYLSIVAALLVFMVAYICGEVGTSSLFRHPIRVFLKDYGTPLTVIFFTGFVHMGRMRDVDLEVLPTGIAFEPTSGRSSWLVRFWDLGVGDIFIALPFAVLLTILFWFDHNVSSLIAQGSEYPLRKPAGFHWDIFLLGITTGVAGILGLPFPNGLIPQAPFHTESLCVTKAVKQLDEKGDDKGEFVYEATHVVEQRVSNLAQGLLTLGTMTGPLLVVIHLIPHGVLAGLFFVMGVQALAANGITSKLIFLARDKSLTPTAASAPLRRIKRRAAIWYFVLIELLGFGATFAITQTVAAVGFPIFIFLLIPLRALVLPRIFTPEELDLLDAPTASDFIMEGIGGSWSGKKGPRTDESLQDEESAVTSSSVLSPSRSSNSVRGGSSRSGSVLAHRQENIDKSQRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.17
5 0.18
6 0.17
7 0.16
8 0.18
9 0.19
10 0.21
11 0.21
12 0.2
13 0.2
14 0.19
15 0.16
16 0.16
17 0.14
18 0.12
19 0.13
20 0.15
21 0.17
22 0.23
23 0.27
24 0.3
25 0.36
26 0.41
27 0.49
28 0.57
29 0.65
30 0.69
31 0.73
32 0.76
33 0.8
34 0.82
35 0.73
36 0.67
37 0.6
38 0.57
39 0.55
40 0.56
41 0.54
42 0.54
43 0.56
44 0.53
45 0.54
46 0.48
47 0.47
48 0.42
49 0.4
50 0.44
51 0.41
52 0.42
53 0.38
54 0.38
55 0.36
56 0.32
57 0.29
58 0.22
59 0.2
60 0.17
61 0.2
62 0.18
63 0.16
64 0.17
65 0.17
66 0.14
67 0.16
68 0.15
69 0.12
70 0.13
71 0.12
72 0.12
73 0.1
74 0.09
75 0.07
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.07
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.12
89 0.12
90 0.13
91 0.14
92 0.17
93 0.17
94 0.16
95 0.16
96 0.14
97 0.12
98 0.1
99 0.09
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.04
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.07
127 0.07
128 0.06
129 0.08
130 0.08
131 0.1
132 0.1
133 0.1
134 0.1
135 0.11
136 0.1
137 0.09
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.09
144 0.08
145 0.08
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.06
166 0.06
167 0.07
168 0.07
169 0.1
170 0.12
171 0.15
172 0.22
173 0.24
174 0.27
175 0.28
176 0.29
177 0.33
178 0.31
179 0.29
180 0.23
181 0.22
182 0.2
183 0.18
184 0.16
185 0.1
186 0.09
187 0.08
188 0.08
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.06
205 0.05
206 0.05
207 0.06
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.03
216 0.03
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.03
227 0.04
228 0.04
229 0.05
230 0.06
231 0.1
232 0.1
233 0.15
234 0.15
235 0.23
236 0.25
237 0.28
238 0.3
239 0.29
240 0.32
241 0.28
242 0.29
243 0.23
244 0.21
245 0.18
246 0.15
247 0.13
248 0.11
249 0.1
250 0.09
251 0.06
252 0.06
253 0.07
254 0.07
255 0.06
256 0.08
257 0.09
258 0.09
259 0.1
260 0.1
261 0.09
262 0.09
263 0.09
264 0.09
265 0.07
266 0.08
267 0.07
268 0.07
269 0.06
270 0.05
271 0.06
272 0.04
273 0.05
274 0.04
275 0.04
276 0.05
277 0.07
278 0.08
279 0.08
280 0.09
281 0.1
282 0.13
283 0.14
284 0.17
285 0.17
286 0.16
287 0.17
288 0.16
289 0.17
290 0.15
291 0.13
292 0.09
293 0.08
294 0.07
295 0.07
296 0.06
297 0.03
298 0.04
299 0.03
300 0.02
301 0.02
302 0.02
303 0.02
304 0.02
305 0.02
306 0.02
307 0.03
308 0.03
309 0.03
310 0.03
311 0.05
312 0.05
313 0.06
314 0.06
315 0.07
316 0.07
317 0.07
318 0.08
319 0.07
320 0.07
321 0.06
322 0.06
323 0.07
324 0.1
325 0.11
326 0.1
327 0.13
328 0.14
329 0.15
330 0.15
331 0.17
332 0.23
333 0.25
334 0.24
335 0.23
336 0.22
337 0.22
338 0.21
339 0.17
340 0.08
341 0.06
342 0.05
343 0.04
344 0.03
345 0.03
346 0.03
347 0.02
348 0.02
349 0.02
350 0.02
351 0.02
352 0.02
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.04
359 0.05
360 0.06
361 0.07
362 0.08
363 0.1
364 0.11
365 0.11
366 0.12
367 0.11
368 0.12
369 0.14
370 0.14
371 0.13
372 0.13
373 0.17
374 0.2
375 0.21
376 0.22
377 0.2
378 0.26
379 0.3
380 0.34
381 0.3
382 0.29
383 0.3
384 0.27
385 0.26
386 0.2
387 0.16
388 0.11
389 0.1
390 0.09
391 0.07
392 0.07
393 0.08
394 0.09
395 0.08
396 0.09
397 0.11
398 0.1
399 0.11
400 0.13
401 0.12
402 0.11
403 0.12
404 0.11
405 0.09
406 0.09
407 0.08
408 0.05
409 0.05
410 0.04
411 0.04
412 0.03
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.03
420 0.04
421 0.04
422 0.04
423 0.04
424 0.04
425 0.04
426 0.04
427 0.04
428 0.03
429 0.03
430 0.03
431 0.03
432 0.03
433 0.03
434 0.03
435 0.03
436 0.03
437 0.03
438 0.03
439 0.02
440 0.02
441 0.02
442 0.03
443 0.03
444 0.03
445 0.03
446 0.03
447 0.04
448 0.04
449 0.04
450 0.05
451 0.06
452 0.07
453 0.09
454 0.15
455 0.16
456 0.18
457 0.18
458 0.21
459 0.23
460 0.24
461 0.22
462 0.18
463 0.19
464 0.24
465 0.25
466 0.23
467 0.27
468 0.33
469 0.39
470 0.43
471 0.46
472 0.47
473 0.53
474 0.57
475 0.61
476 0.6
477 0.58
478 0.55
479 0.53
480 0.47
481 0.39
482 0.33
483 0.22
484 0.16
485 0.11
486 0.09
487 0.05
488 0.03
489 0.03
490 0.03
491 0.03
492 0.03
493 0.03
494 0.04
495 0.04
496 0.04
497 0.04
498 0.05
499 0.05
500 0.05
501 0.06
502 0.05
503 0.06
504 0.05
505 0.06
506 0.05
507 0.05
508 0.06
509 0.06
510 0.09
511 0.08
512 0.09
513 0.08
514 0.1
515 0.1
516 0.11
517 0.14
518 0.13
519 0.14
520 0.15
521 0.21
522 0.2
523 0.2
524 0.24
525 0.21
526 0.2
527 0.2
528 0.2
529 0.15
530 0.15
531 0.15
532 0.11
533 0.09
534 0.08
535 0.08
536 0.06
537 0.06
538 0.05
539 0.05
540 0.05
541 0.05
542 0.05
543 0.05
544 0.05
545 0.05
546 0.06
547 0.07
548 0.08
549 0.12
550 0.17
551 0.21
552 0.27
553 0.34
554 0.39
555 0.45
556 0.49
557 0.55
558 0.58
559 0.56
560 0.52
561 0.46
562 0.41
563 0.33
564 0.29
565 0.21
566 0.14
567 0.1
568 0.09
569 0.09
570 0.1
571 0.12
572 0.12
573 0.13
574 0.15
575 0.19
576 0.23
577 0.26
578 0.28
579 0.32
580 0.39
581 0.41
582 0.41
583 0.4
584 0.41
585 0.42
586 0.4
587 0.35
588 0.29
589 0.26
590 0.25
591 0.27
592 0.31
593 0.32
594 0.35
595 0.34
596 0.37
597 0.41
598 0.45
599 0.47