Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1W6Y8

Protein Details
Accession M1W6Y8    Localization Confidence High Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGHYRHRRLKSRYRMEPVLTHydrophilic
22-41QVPRKRQQSDRERLKKRIPNBasic
90-109SDGGAKRVPTREKTKRKRERBasic
NLS Segment(s)
PositionSequence
32-38RERLKKR
65-78VRRPNGKVLIKKLP
91-109DGGAKRVPTREKTKRKRER
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MGHYRHRRLKSRYRMEPVLTIQVPRKRQQSDRERLKKRIPNQKGQEVISSPEKMFGSSKSVRSGVRRPNGKVLIKKLPGGPTSTPEDKISDGGAKRVPTREKTKRKRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.71
4 0.64
5 0.61
6 0.51
7 0.44
8 0.43
9 0.43
10 0.45
11 0.44
12 0.48
13 0.45
14 0.51
15 0.59
16 0.62
17 0.67
18 0.73
19 0.78
20 0.78
21 0.8
22 0.83
23 0.8
24 0.78
25 0.78
26 0.74
27 0.74
28 0.73
29 0.74
30 0.68
31 0.61
32 0.55
33 0.44
34 0.4
35 0.34
36 0.28
37 0.21
38 0.2
39 0.19
40 0.17
41 0.17
42 0.14
43 0.17
44 0.19
45 0.21
46 0.2
47 0.22
48 0.23
49 0.28
50 0.34
51 0.36
52 0.41
53 0.45
54 0.45
55 0.51
56 0.57
57 0.58
58 0.56
59 0.53
60 0.55
61 0.51
62 0.51
63 0.47
64 0.44
65 0.4
66 0.39
67 0.34
68 0.28
69 0.34
70 0.34
71 0.32
72 0.28
73 0.29
74 0.25
75 0.25
76 0.23
77 0.22
78 0.2
79 0.22
80 0.25
81 0.26
82 0.28
83 0.35
84 0.39
85 0.41
86 0.51
87 0.59
88 0.66
89 0.75