Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M1WE45

Protein Details
Accession M1WE45    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-38LELFRLEQRYTRRRNRRSTFQTNAIYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MGQSILHRIQAKLELFRLEQRYTRRRNRRSTFQTNAIYVDGEYVFQTPNSTGSSATDSTSPRVDALHGEMMAANKTTPITSFSAGVPQEAATSERKRLHRFSSIPSFGGTFGFKERHQVMERRTSMIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.36
4 0.38
5 0.34
6 0.36
7 0.42
8 0.49
9 0.55
10 0.64
11 0.68
12 0.73
13 0.81
14 0.84
15 0.86
16 0.86
17 0.86
18 0.82
19 0.8
20 0.75
21 0.65
22 0.58
23 0.47
24 0.38
25 0.28
26 0.22
27 0.13
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.08
34 0.06
35 0.08
36 0.09
37 0.09
38 0.08
39 0.09
40 0.13
41 0.12
42 0.13
43 0.14
44 0.13
45 0.14
46 0.15
47 0.14
48 0.11
49 0.1
50 0.1
51 0.08
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.06
61 0.05
62 0.06
63 0.06
64 0.05
65 0.08
66 0.1
67 0.1
68 0.12
69 0.12
70 0.16
71 0.16
72 0.16
73 0.13
74 0.11
75 0.11
76 0.1
77 0.12
78 0.13
79 0.15
80 0.21
81 0.27
82 0.33
83 0.38
84 0.42
85 0.46
86 0.5
87 0.51
88 0.53
89 0.57
90 0.54
91 0.49
92 0.45
93 0.4
94 0.32
95 0.3
96 0.23
97 0.14
98 0.16
99 0.18
100 0.18
101 0.24
102 0.26
103 0.31
104 0.36
105 0.41
106 0.43
107 0.51
108 0.53