Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DVX4

Protein Details
Accession B0DVX4    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-117KTSHHPPKNTSAHRKTRAAHBasic
NLS Segment(s)
PositionSequence
54-80RNPRKHPTPTKTTPPDTKRHPTGTKRR
105-123KNTSAHRKTRAAHRKTRAA
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG lbc:LACBIDRAFT_333442  -  
Amino Acid Sequences MLVTAANATPSPSPIATTANIAPRSPMATTTTNINHNTLQQQRGDATSRNNERRNPRKHPTPTKTTPPDTKRHPTGTKRRPPPMYTASAHENHTPPTKTSHHPPKNTSAHRKTRAAHRKTRAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.16
4 0.19
5 0.21
6 0.26
7 0.27
8 0.25
9 0.25
10 0.23
11 0.24
12 0.21
13 0.19
14 0.16
15 0.17
16 0.18
17 0.23
18 0.25
19 0.28
20 0.29
21 0.29
22 0.25
23 0.25
24 0.31
25 0.3
26 0.29
27 0.25
28 0.25
29 0.24
30 0.25
31 0.25
32 0.21
33 0.21
34 0.27
35 0.34
36 0.4
37 0.44
38 0.47
39 0.55
40 0.63
41 0.67
42 0.67
43 0.66
44 0.68
45 0.74
46 0.79
47 0.75
48 0.75
49 0.71
50 0.72
51 0.71
52 0.66
53 0.65
54 0.59
55 0.59
56 0.57
57 0.59
58 0.55
59 0.57
60 0.59
61 0.6
62 0.66
63 0.71
64 0.73
65 0.74
66 0.77
67 0.75
68 0.7
69 0.68
70 0.63
71 0.58
72 0.5
73 0.46
74 0.43
75 0.4
76 0.4
77 0.36
78 0.31
79 0.28
80 0.32
81 0.3
82 0.26
83 0.3
84 0.33
85 0.34
86 0.43
87 0.51
88 0.54
89 0.6
90 0.64
91 0.68
92 0.73
93 0.78
94 0.79
95 0.78
96 0.79
97 0.8
98 0.81
99 0.77
100 0.78
101 0.78
102 0.76
103 0.77
104 0.75