Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0CTF7

Protein Details
Accession B0CTF7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-56CTEVKVKKCRTRVRRARFAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.833, cyto 10, cyto_pero 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR010339  TIP49_P-loop  
Gene Ontology GO:0005524  F:ATP binding  
KEGG lbc:LACBIDRAFT_305110  -  
Pfam View protein in Pfam  
PF06068  TIP49  
Amino Acid Sequences MQINQCLQTTSDDGEQVLSASRQPIMSVIGSLVKSGCTEVKVKKCRTRVRRARFAEVVPGVVFIVEVHMLDTETTDNNGMTTWDNDDKGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.11
5 0.09
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.1
13 0.1
14 0.09
15 0.09
16 0.11
17 0.1
18 0.11
19 0.1
20 0.08
21 0.08
22 0.09
23 0.09
24 0.08
25 0.12
26 0.18
27 0.27
28 0.35
29 0.41
30 0.47
31 0.55
32 0.63
33 0.68
34 0.73
35 0.75
36 0.76
37 0.8
38 0.79
39 0.77
40 0.71
41 0.62
42 0.58
43 0.47
44 0.39
45 0.28
46 0.24
47 0.16
48 0.13
49 0.12
50 0.05
51 0.06
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.16
70 0.19