Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A1Z1

Protein Details
Accession Q5A1Z1   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
150-181RIQSRFIRPAKYRKQLKREWWRRRFSQGFKELHydrophilic
NLS Segment(s)
PositionSequence
160-168KYRKQLKRE
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0070124  P:mitochondrial translational initiation  
KEGG cal:CAALFM_CR02950CA  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MMKSILGSGLINNIAKSSLNKSVLRPSYTPIRFNSNNANLDQLKSIFNQLNEKSTTTNDSQTKSTLNIDDLLSNSILETRERPQSNSFGVYDKFGFEQTRQPTPREVAKNIREFGVNAGRTVDVSYNNISRSFAQVKRVVNDNKIRYLQRIQSRFIRPAKYRKQLKREWWRRRFSQGFKELLHDVNDARRRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.18
5 0.23
6 0.29
7 0.31
8 0.33
9 0.42
10 0.47
11 0.49
12 0.45
13 0.41
14 0.46
15 0.48
16 0.49
17 0.42
18 0.45
19 0.42
20 0.44
21 0.5
22 0.47
23 0.46
24 0.42
25 0.45
26 0.37
27 0.36
28 0.35
29 0.26
30 0.2
31 0.18
32 0.22
33 0.19
34 0.2
35 0.26
36 0.25
37 0.28
38 0.28
39 0.29
40 0.26
41 0.24
42 0.27
43 0.22
44 0.28
45 0.27
46 0.28
47 0.28
48 0.27
49 0.27
50 0.25
51 0.25
52 0.19
53 0.17
54 0.16
55 0.15
56 0.15
57 0.14
58 0.14
59 0.11
60 0.1
61 0.09
62 0.08
63 0.08
64 0.08
65 0.1
66 0.11
67 0.19
68 0.2
69 0.22
70 0.23
71 0.26
72 0.27
73 0.27
74 0.25
75 0.2
76 0.19
77 0.19
78 0.16
79 0.14
80 0.12
81 0.11
82 0.11
83 0.1
84 0.16
85 0.18
86 0.26
87 0.27
88 0.28
89 0.29
90 0.3
91 0.37
92 0.34
93 0.35
94 0.36
95 0.41
96 0.45
97 0.43
98 0.42
99 0.35
100 0.31
101 0.31
102 0.3
103 0.23
104 0.18
105 0.18
106 0.18
107 0.17
108 0.18
109 0.15
110 0.08
111 0.1
112 0.12
113 0.13
114 0.14
115 0.15
116 0.15
117 0.14
118 0.19
119 0.23
120 0.23
121 0.28
122 0.32
123 0.34
124 0.35
125 0.43
126 0.4
127 0.41
128 0.48
129 0.45
130 0.46
131 0.48
132 0.47
133 0.44
134 0.47
135 0.47
136 0.48
137 0.48
138 0.47
139 0.51
140 0.55
141 0.58
142 0.59
143 0.59
144 0.57
145 0.64
146 0.7
147 0.71
148 0.76
149 0.78
150 0.82
151 0.82
152 0.87
153 0.88
154 0.89
155 0.9
156 0.89
157 0.88
158 0.84
159 0.86
160 0.84
161 0.82
162 0.81
163 0.78
164 0.74
165 0.66
166 0.64
167 0.56
168 0.5
169 0.43
170 0.34
171 0.28
172 0.32
173 0.37