Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0E2K7

Protein Details
Accession B0E2K7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
252-275RLSHRVGHPTRPPRPRRPLQTMRHBasic
NLS Segment(s)
PositionSequence
265-265R
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_318515  -  
Amino Acid Sequences MLGKMVANEVQHWGAMLFDFYHVRRMHDFGGLQSTSTGSKWMKASGEDYTKEELQLVEEEEDLKESFPCDIAKLVEDVEMRISKTLSESEGERKKEGFIRPEPFDTTFNSLPILQQRLPLHLLPTTLYVHDQFRLLQVRDGHFKEHHPQPWSSKPDIVHAYSHNASPAGREKMEKEQEKLISDREVEEALRKGAKLEEHSSALALYGQPHPWINQTLGIRNARAFLSSQFCRRSPSAPLAFPPGGQRESLFRLSHRVGHPTRPPRPRRPLQTMRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.07
5 0.09
6 0.12
7 0.13
8 0.2
9 0.21
10 0.24
11 0.26
12 0.29
13 0.29
14 0.31
15 0.31
16 0.25
17 0.32
18 0.28
19 0.25
20 0.22
21 0.22
22 0.18
23 0.17
24 0.2
25 0.14
26 0.18
27 0.19
28 0.22
29 0.23
30 0.23
31 0.26
32 0.27
33 0.33
34 0.31
35 0.32
36 0.33
37 0.32
38 0.3
39 0.28
40 0.21
41 0.17
42 0.17
43 0.15
44 0.12
45 0.11
46 0.12
47 0.11
48 0.13
49 0.11
50 0.1
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.13
63 0.12
64 0.12
65 0.14
66 0.14
67 0.14
68 0.14
69 0.13
70 0.1
71 0.12
72 0.12
73 0.1
74 0.1
75 0.12
76 0.2
77 0.27
78 0.29
79 0.29
80 0.28
81 0.3
82 0.34
83 0.37
84 0.35
85 0.35
86 0.39
87 0.41
88 0.42
89 0.43
90 0.39
91 0.36
92 0.31
93 0.3
94 0.24
95 0.22
96 0.2
97 0.18
98 0.17
99 0.19
100 0.21
101 0.15
102 0.2
103 0.2
104 0.21
105 0.24
106 0.23
107 0.2
108 0.17
109 0.17
110 0.12
111 0.14
112 0.12
113 0.1
114 0.11
115 0.11
116 0.11
117 0.11
118 0.11
119 0.09
120 0.12
121 0.16
122 0.15
123 0.17
124 0.18
125 0.2
126 0.25
127 0.25
128 0.25
129 0.21
130 0.23
131 0.26
132 0.3
133 0.33
134 0.31
135 0.32
136 0.35
137 0.42
138 0.46
139 0.41
140 0.38
141 0.34
142 0.36
143 0.37
144 0.33
145 0.27
146 0.23
147 0.26
148 0.24
149 0.23
150 0.18
151 0.16
152 0.14
153 0.14
154 0.19
155 0.17
156 0.17
157 0.18
158 0.21
159 0.29
160 0.38
161 0.39
162 0.35
163 0.38
164 0.4
165 0.41
166 0.4
167 0.32
168 0.26
169 0.23
170 0.22
171 0.17
172 0.16
173 0.13
174 0.15
175 0.14
176 0.14
177 0.14
178 0.13
179 0.13
180 0.14
181 0.17
182 0.19
183 0.21
184 0.22
185 0.23
186 0.23
187 0.23
188 0.2
189 0.17
190 0.14
191 0.1
192 0.1
193 0.1
194 0.11
195 0.12
196 0.13
197 0.14
198 0.16
199 0.18
200 0.16
201 0.2
202 0.21
203 0.24
204 0.3
205 0.31
206 0.3
207 0.28
208 0.29
209 0.23
210 0.22
211 0.19
212 0.16
213 0.22
214 0.24
215 0.3
216 0.33
217 0.34
218 0.38
219 0.39
220 0.38
221 0.37
222 0.43
223 0.43
224 0.41
225 0.42
226 0.44
227 0.43
228 0.4
229 0.4
230 0.35
231 0.3
232 0.28
233 0.26
234 0.24
235 0.29
236 0.34
237 0.3
238 0.26
239 0.33
240 0.35
241 0.41
242 0.39
243 0.43
244 0.41
245 0.49
246 0.58
247 0.6
248 0.68
249 0.71
250 0.77
251 0.79
252 0.86
253 0.87
254 0.87
255 0.88