Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0CPW5

Protein Details
Accession B0CPW5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24NGHRSISQWKGRRRQDCRNDLEGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_301910  -  
Amino Acid Sequences MNGHRSISQWKGRRRQDCRNDLEGWVAIRRCVDQLPIQTSGLKLASSDTQRCNRLTKLSGVAGAESVGCRRAFLDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.83
4 0.84
5 0.82
6 0.77
7 0.7
8 0.6
9 0.54
10 0.44
11 0.35
12 0.29
13 0.22
14 0.17
15 0.15
16 0.15
17 0.13
18 0.13
19 0.13
20 0.13
21 0.17
22 0.19
23 0.21
24 0.2
25 0.2
26 0.19
27 0.18
28 0.15
29 0.11
30 0.08
31 0.07
32 0.11
33 0.14
34 0.17
35 0.21
36 0.27
37 0.3
38 0.32
39 0.34
40 0.33
41 0.35
42 0.34
43 0.33
44 0.33
45 0.31
46 0.31
47 0.28
48 0.26
49 0.2
50 0.18
51 0.14
52 0.1
53 0.09
54 0.11
55 0.1
56 0.1
57 0.11