Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0D3Y2

Protein Details
Accession B0D3Y2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-26SRQAGKLKPLKAPKKEKKEEMEEDBasic
NLS Segment(s)
PositionSequence
7-65GKLKPLKAPKKEKKEEMEEDVAFKEKKKAEAEALKAARDKAMKSSGPLVGGGIKKSGKK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG lbc:LACBIDRAFT_316099  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSSRQAGKLKPLKAPKKEKKEEMEEDVAFKEKKKAEAEALKAARDKAMKSSGPLVGGGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.81
4 0.85
5 0.84
6 0.81
7 0.8
8 0.76
9 0.71
10 0.66
11 0.55
12 0.48
13 0.41
14 0.36
15 0.27
16 0.22
17 0.22
18 0.17
19 0.22
20 0.22
21 0.23
22 0.27
23 0.32
24 0.36
25 0.38
26 0.38
27 0.35
28 0.35
29 0.33
30 0.3
31 0.26
32 0.23
33 0.19
34 0.24
35 0.24
36 0.25
37 0.29
38 0.28
39 0.27
40 0.26
41 0.22
42 0.21
43 0.23
44 0.21
45 0.21