FuNGI

A0A1D8PHG0

Protein Details

Accession

A0A1D8PHG0

Localization Confidence

Low

Confidence Score

8.6

NoLS Segment(s)

Position	Sequence	Protein Nature
8-33	KQVVRCLSCKKLRIKCDQVRPKCEYC	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, nucl 11.5, cyto_nucl 8.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding GO:0036180 P:filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:1900443 P:regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	cal:CAALFM_C205770WA -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MAAKKGRKQVVRCLSCKKLRIKCDQVRPKCEYCAHTNRECIYPSDIPTSETNAEKDSPVEDIRRDLPLTQLTSVLSVSQLELRALKFFNDIGKLIVSYKNQRYIDNWEAVINPLSFQSPIVKKTLLATSSMLLSHFMNINTVDSKVLTSSFSVDSSQEAQAFFQTGTKYLQESIDERKHLLQDNSGFGIERIIVNDLITFGCLLIYNHKLVPLISATGYDVISMAKAYSDTRKMYSQSMTGLRLESLFFPKSNPILTCPPETNYWFTRVLEFEIVAFVSRNGNKSANMEEYFQALMDTFLLLKDACYAMAIVRFPFPLIACLTNFSDKYRQLLRNGDEFAFRLLFIYSCLCVISRIPLNRNDNIFVDYISEFKNIIFSKYGEFSYPIDRELYHLVIRTNFVVDFGDMTRFHPLQQCEPLMDLSWLERYIDSLEKTNTLLQCI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.75
3	0.78
4	0.77
5	0.75
6	0.75
7	0.79
8	0.82
9	0.81
10	0.85
11	0.87
12	0.87
13	0.87
14	0.85
15	0.79
16	0.75
17	0.72
18	0.66
19	0.65
20	0.65
21	0.64
22	0.62
23	0.64
24	0.59
25	0.57
26	0.53
27	0.46
28	0.43
29	0.4
30	0.37
31	0.38
32	0.35
33	0.34
34	0.34
35	0.36
36	0.33
37	0.31
38	0.29
39	0.25
40	0.26
41	0.24
42	0.23
43	0.18
44	0.19
45	0.2
46	0.22
47	0.2
48	0.23
49	0.24
50	0.27
51	0.27
52	0.24
53	0.25
54	0.27
55	0.29
56	0.26
57	0.25
58	0.21
59	0.21
60	0.21
61	0.16
62	0.11
63	0.09
64	0.09
65	0.1
66	0.11
67	0.11
68	0.13
69	0.13
70	0.16
71	0.16
72	0.16
73	0.15
74	0.15
75	0.18
76	0.19
77	0.18
78	0.17
79	0.17
80	0.17
81	0.17
82	0.21
83	0.21
84	0.27
85	0.31
86	0.39
87	0.39
88	0.4
89	0.41
90	0.45
91	0.47
92	0.42
93	0.37
94	0.3
95	0.29
96	0.29
97	0.29
98	0.2
99	0.14
100	0.12
101	0.12
102	0.11
103	0.11
104	0.17
105	0.17
106	0.19
107	0.22
108	0.22
109	0.21
110	0.24
111	0.29
112	0.22
113	0.2
114	0.19
115	0.17
116	0.18
117	0.17
118	0.14
119	0.11
120	0.1
121	0.1
122	0.11
123	0.1
124	0.11
125	0.11
126	0.12
127	0.12
128	0.12
129	0.11
130	0.09
131	0.09
132	0.08
133	0.09
134	0.08
135	0.07
136	0.09
137	0.1
138	0.1
139	0.11
140	0.11
141	0.12
142	0.14
143	0.15
144	0.13
145	0.13
146	0.12
147	0.12
148	0.12
149	0.11
150	0.1
151	0.1
152	0.1
153	0.11
154	0.12
155	0.12
156	0.12
157	0.13
158	0.13
159	0.15
160	0.21
161	0.24
162	0.24
163	0.24
164	0.25
165	0.27
166	0.29
167	0.27
168	0.24
169	0.22
170	0.23
171	0.23
172	0.21
173	0.19
174	0.15
175	0.14
176	0.1
177	0.08
178	0.07
179	0.07
180	0.07
181	0.06
182	0.07
183	0.07
184	0.06
185	0.06
186	0.05
187	0.04
188	0.04
189	0.04
190	0.05
191	0.07
192	0.09
193	0.1
194	0.1
195	0.11
196	0.11
197	0.1
198	0.11
199	0.09
200	0.08
201	0.07
202	0.07
203	0.07
204	0.07
205	0.07
206	0.06
207	0.06
208	0.05
209	0.05
210	0.04
211	0.04
212	0.03
213	0.04
214	0.05
215	0.08
216	0.12
217	0.13
218	0.15
219	0.18
220	0.19
221	0.21
222	0.22
223	0.2
224	0.2
225	0.21
226	0.21
227	0.19
228	0.18
229	0.15
230	0.14
231	0.14
232	0.11
233	0.12
234	0.12
235	0.11
236	0.12
237	0.14
238	0.15
239	0.16
240	0.16
241	0.16
242	0.2
243	0.23
244	0.25
245	0.24
246	0.25
247	0.26
248	0.27
249	0.27
250	0.23
251	0.25
252	0.23
253	0.23
254	0.23
255	0.2
256	0.2
257	0.17
258	0.15
259	0.11
260	0.1
261	0.1
262	0.08
263	0.07
264	0.06
265	0.1
266	0.11
267	0.13
268	0.15
269	0.16
270	0.17
271	0.19
272	0.22
273	0.22
274	0.22
275	0.22
276	0.2
277	0.2
278	0.19
279	0.17
280	0.14
281	0.09
282	0.08
283	0.06
284	0.06
285	0.04
286	0.04
287	0.05
288	0.05
289	0.05
290	0.06
291	0.06
292	0.06
293	0.06
294	0.06
295	0.07
296	0.09
297	0.1
298	0.09
299	0.1
300	0.1
301	0.1
302	0.11
303	0.11
304	0.1
305	0.12
306	0.13
307	0.12
308	0.15
309	0.17
310	0.2
311	0.2
312	0.21
313	0.25
314	0.24
315	0.28
316	0.34
317	0.36
318	0.37
319	0.44
320	0.44
321	0.44
322	0.46
323	0.42
324	0.36
325	0.32
326	0.3
327	0.23
328	0.19
329	0.14
330	0.11
331	0.1
332	0.1
333	0.11
334	0.09
335	0.09
336	0.09
337	0.09
338	0.09
339	0.1
340	0.14
341	0.19
342	0.24
343	0.28
344	0.36
345	0.41
346	0.45
347	0.47
348	0.44
349	0.4
350	0.37
351	0.33
352	0.25
353	0.23
354	0.18
355	0.17
356	0.16
357	0.15
358	0.13
359	0.12
360	0.19
361	0.17
362	0.19
363	0.19
364	0.19
365	0.22
366	0.24
367	0.25
368	0.2
369	0.22
370	0.21
371	0.27
372	0.27
373	0.24
374	0.23
375	0.22
376	0.23
377	0.25
378	0.26
379	0.2
380	0.22
381	0.23
382	0.23
383	0.25
384	0.23
385	0.21
386	0.18
387	0.16
388	0.15
389	0.14
390	0.14
391	0.13
392	0.17
393	0.15
394	0.17
395	0.23
396	0.22
397	0.24
398	0.29
399	0.32
400	0.34
401	0.41
402	0.41
403	0.36
404	0.38
405	0.37
406	0.31
407	0.28
408	0.22
409	0.16
410	0.18
411	0.17
412	0.16
413	0.15
414	0.15
415	0.17
416	0.22
417	0.22
418	0.25
419	0.26
420	0.27
421	0.29
422	0.34

A0A1D8PHG0

3D AlphaFold-predicted Structure Viewer