Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DJ41

Protein Details
Accession B0DJ41    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-92TTKARRENSAGTRKPKRKISHydrophilic
NLS Segment(s)
PositionSequence
76-92ARRENSAGTRKPKRKIS
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
KEGG lbc:LACBIDRAFT_303199  -  
Amino Acid Sequences MTKARVRLPMRFGHSFRISVAPKESWEVHAQKKSNFARFRPAVSPIIAETLEDGGMRGATPPPKTLETKLTPTTKARRENSAGTRKPKRKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.43
4 0.43
5 0.37
6 0.33
7 0.35
8 0.28
9 0.26
10 0.29
11 0.28
12 0.23
13 0.27
14 0.29
15 0.32
16 0.37
17 0.38
18 0.36
19 0.45
20 0.47
21 0.49
22 0.49
23 0.44
24 0.47
25 0.46
26 0.48
27 0.4
28 0.39
29 0.32
30 0.28
31 0.27
32 0.18
33 0.18
34 0.14
35 0.12
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.04
42 0.04
43 0.04
44 0.04
45 0.07
46 0.1
47 0.11
48 0.13
49 0.16
50 0.2
51 0.23
52 0.25
53 0.31
54 0.32
55 0.37
56 0.42
57 0.42
58 0.43
59 0.47
60 0.53
61 0.53
62 0.58
63 0.55
64 0.57
65 0.59
66 0.64
67 0.67
68 0.69
69 0.69
70 0.69
71 0.77
72 0.77