Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S0EIP3

Protein Details
Accession S0EIP3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-40RLAARASSARKERRKRSQAPKDKVAKAHydrophilic
NLS Segment(s)
PositionSequence
12-79KNRLAARASSARKERRKRSQAPKDKVAKADTTRGARPGLLPTSGPRAKVSAKKARKIEKRLAHAMKRK
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MPSVGNPNGPSKNRLAARASSARKERRKRSQAPKDKVAKADTTRGARPGLLPTSGPRAKVSAKKARKIEKRLAHAMKRKMEAEGEAEMKDAPEVEGEGEKAEEVEMGDIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.37
4 0.42
5 0.48
6 0.49
7 0.48
8 0.54
9 0.59
10 0.65
11 0.72
12 0.75
13 0.77
14 0.82
15 0.85
16 0.88
17 0.89
18 0.9
19 0.88
20 0.88
21 0.86
22 0.8
23 0.74
24 0.65
25 0.6
26 0.51
27 0.5
28 0.45
29 0.4
30 0.37
31 0.35
32 0.32
33 0.26
34 0.25
35 0.21
36 0.18
37 0.14
38 0.13
39 0.13
40 0.2
41 0.21
42 0.21
43 0.18
44 0.18
45 0.22
46 0.27
47 0.34
48 0.36
49 0.42
50 0.48
51 0.55
52 0.63
53 0.68
54 0.69
55 0.71
56 0.69
57 0.69
58 0.72
59 0.72
60 0.71
61 0.7
62 0.71
63 0.67
64 0.63
65 0.57
66 0.48
67 0.42
68 0.35
69 0.3
70 0.26
71 0.21
72 0.18
73 0.18
74 0.16
75 0.15
76 0.13
77 0.1
78 0.07
79 0.06
80 0.06
81 0.07
82 0.08
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06