Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E0N8

Protein Details
Accession B0E0N8   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-100PPWQYDRWEKEKKKIRQRSPEERMPIHydrophilic
NLS Segment(s)
PositionSequence
85-91EKKKIRQ
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
KEGG lbc:LACBIDRAFT_334888  -  
Amino Acid Sequences MIKIPTKTTAYNPSPAHLTSRVQHLPYNPISNPLLVYWSLGSTPRTKRDTKHITVTSKSFVWESNLVFAHRMRMPPWQYDRWEKEKKKIRQRSPEERMPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.38
4 0.31
5 0.31
6 0.25
7 0.32
8 0.34
9 0.32
10 0.34
11 0.31
12 0.35
13 0.35
14 0.38
15 0.29
16 0.3
17 0.29
18 0.27
19 0.25
20 0.19
21 0.17
22 0.12
23 0.12
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.14
30 0.18
31 0.24
32 0.28
33 0.3
34 0.31
35 0.4
36 0.47
37 0.45
38 0.5
39 0.49
40 0.49
41 0.5
42 0.49
43 0.41
44 0.33
45 0.3
46 0.22
47 0.17
48 0.17
49 0.17
50 0.15
51 0.17
52 0.18
53 0.17
54 0.18
55 0.18
56 0.19
57 0.18
58 0.19
59 0.16
60 0.24
61 0.27
62 0.33
63 0.4
64 0.41
65 0.44
66 0.53
67 0.59
68 0.6
69 0.68
70 0.64
71 0.68
72 0.73
73 0.78
74 0.79
75 0.83
76 0.84
77 0.84
78 0.9
79 0.91
80 0.9