Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DXC7

Protein Details
Accession B0DXC7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-36QTKFSNFENKQRRKGKCQRDKKTGREPSSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 1, plas 1, extr 1, pero 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
KEGG lbc:LACBIDRAFT_313016  -  
Amino Acid Sequences MNRGSLQTKFSNFENKQRRKGKCQRDKKTGREPSSNPTPQKHLAFLLVLLNALSSLPTSLIVAHSPDSVPIAVADKHDVRLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.64
4 0.7
5 0.74
6 0.74
7 0.82
8 0.83
9 0.83
10 0.86
11 0.86
12 0.88
13 0.9
14 0.88
15 0.88
16 0.87
17 0.82
18 0.78
19 0.71
20 0.67
21 0.67
22 0.65
23 0.57
24 0.49
25 0.48
26 0.44
27 0.43
28 0.37
29 0.27
30 0.22
31 0.19
32 0.17
33 0.14
34 0.09
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.09
53 0.1
54 0.11
55 0.1
56 0.09
57 0.09
58 0.11
59 0.11
60 0.13
61 0.17
62 0.17
63 0.19