Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CTU6

Protein Details
Accession B0CTU6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
110-129KWWHERHKAGRVPSRPRRRWBasic
NLS Segment(s)
PositionSequence
115-128RHKAGRVPSRPRRR
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040125  Squalene_monox  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004506  F:squalene monooxygenase activity  
GO:0016126  P:sterol biosynthetic process  
KEGG lbc:LACBIDRAFT_305270  -  
Amino Acid Sequences MIVLSPMDYPPSFAQNHSEYVYSNARSLSQIVGEFLQPGGVTALRKPGIEKCPGGIDAIRVKGYCVVEDGKSVEIPYPGRHEGWRYHGLTRRGERCCRGTCGGFLGKTVKWWHERHKAGRVPSRPRRRWGVSPTSTWQLWVPPSASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.29
4 0.27
5 0.25
6 0.21
7 0.25
8 0.3
9 0.25
10 0.24
11 0.21
12 0.21
13 0.21
14 0.21
15 0.17
16 0.14
17 0.13
18 0.13
19 0.13
20 0.12
21 0.12
22 0.1
23 0.1
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.14
31 0.14
32 0.15
33 0.16
34 0.22
35 0.25
36 0.29
37 0.29
38 0.24
39 0.26
40 0.26
41 0.26
42 0.19
43 0.18
44 0.16
45 0.17
46 0.17
47 0.14
48 0.14
49 0.17
50 0.17
51 0.14
52 0.12
53 0.12
54 0.12
55 0.13
56 0.13
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.1
64 0.13
65 0.14
66 0.15
67 0.15
68 0.17
69 0.19
70 0.24
71 0.29
72 0.27
73 0.31
74 0.36
75 0.39
76 0.43
77 0.47
78 0.48
79 0.48
80 0.5
81 0.5
82 0.5
83 0.49
84 0.48
85 0.45
86 0.39
87 0.34
88 0.35
89 0.34
90 0.28
91 0.26
92 0.24
93 0.2
94 0.23
95 0.25
96 0.24
97 0.28
98 0.32
99 0.4
100 0.47
101 0.55
102 0.58
103 0.65
104 0.66
105 0.68
106 0.73
107 0.73
108 0.73
109 0.76
110 0.81
111 0.78
112 0.78
113 0.79
114 0.77
115 0.77
116 0.75
117 0.76
118 0.7
119 0.69
120 0.68
121 0.64
122 0.57
123 0.49
124 0.41
125 0.34
126 0.31
127 0.29