Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E1P7

Protein Details
Accession B0E1P7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-59APSPTRPPLRLTRPRPRRPHVDTQGCRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG lbc:LACBIDRAFT_316828  -  
Amino Acid Sequences MPQQTESSAEAHRRGPSATWRTNRQYSTVQPAPSPTRPPLRLTRPRPRRPHVDTQGCRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.31
4 0.36
5 0.41
6 0.43
7 0.48
8 0.53
9 0.58
10 0.56
11 0.5
12 0.46
13 0.41
14 0.44
15 0.41
16 0.36
17 0.3
18 0.33
19 0.34
20 0.32
21 0.33
22 0.28
23 0.32
24 0.34
25 0.38
26 0.43
27 0.48
28 0.56
29 0.62
30 0.69
31 0.72
32 0.8
33 0.86
34 0.84
35 0.84
36 0.82
37 0.84
38 0.84
39 0.84