Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D3T7

Protein Details
Accession B0D3T7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MANPRQRRKTRSSTHKAVSHSRHAKRNLKKMPPIRGPKALHydrophilic
NLS Segment(s)
PositionSequence
5-39RQRRKTRSSTHKAVSHSRHAKRNLKKMPPIRGPKA
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG lbc:LACBIDRAFT_192580  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKTRSSTHKAVSHSRHAKRNLKKMPPIRGPKALQEAWDKKKTVKQNYTALGLIHSTNPSASGGNEQPSTHRIIEIPAEIPSASTTVDRTIPVGFGKIIRDEAGNVLHVELNDTEEESAATVANSTEMKNIQIDNDITTRWVTDLGGHPKDIAVSEKGGQLLETLESLSCIKHMGSATLSVPLSGAGPRHAAAGEVAYLQRLVKKYGNDVERMAIDRKLNPDQRTAGQLKRALRNSGLQISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.78
4 0.77
5 0.73
6 0.73
7 0.73
8 0.71
9 0.71
10 0.75
11 0.79
12 0.79
13 0.83
14 0.82
15 0.81
16 0.84
17 0.83
18 0.84
19 0.85
20 0.85
21 0.8
22 0.79
23 0.72
24 0.69
25 0.69
26 0.59
27 0.53
28 0.54
29 0.56
30 0.55
31 0.59
32 0.53
33 0.49
34 0.55
35 0.61
36 0.61
37 0.61
38 0.6
39 0.62
40 0.64
41 0.63
42 0.57
43 0.47
44 0.37
45 0.3
46 0.23
47 0.17
48 0.14
49 0.11
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.12
56 0.14
57 0.16
58 0.18
59 0.17
60 0.18
61 0.19
62 0.23
63 0.18
64 0.17
65 0.14
66 0.15
67 0.17
68 0.16
69 0.15
70 0.11
71 0.12
72 0.11
73 0.11
74 0.09
75 0.08
76 0.07
77 0.06
78 0.07
79 0.07
80 0.09
81 0.09
82 0.09
83 0.09
84 0.1
85 0.09
86 0.1
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.09
94 0.09
95 0.1
96 0.09
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.05
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.08
125 0.1
126 0.1
127 0.11
128 0.11
129 0.1
130 0.1
131 0.1
132 0.1
133 0.08
134 0.08
135 0.06
136 0.08
137 0.15
138 0.21
139 0.22
140 0.22
141 0.21
142 0.21
143 0.21
144 0.19
145 0.15
146 0.09
147 0.1
148 0.11
149 0.12
150 0.13
151 0.12
152 0.12
153 0.1
154 0.09
155 0.08
156 0.07
157 0.06
158 0.05
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.09
166 0.09
167 0.1
168 0.11
169 0.13
170 0.13
171 0.16
172 0.16
173 0.13
174 0.12
175 0.11
176 0.11
177 0.1
178 0.1
179 0.08
180 0.09
181 0.1
182 0.11
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.08
190 0.08
191 0.08
192 0.08
193 0.12
194 0.13
195 0.17
196 0.19
197 0.22
198 0.28
199 0.36
200 0.39
201 0.38
202 0.38
203 0.36
204 0.35
205 0.36
206 0.31
207 0.27
208 0.27
209 0.28
210 0.32
211 0.39
212 0.44
213 0.43
214 0.46
215 0.47
216 0.47
217 0.52
218 0.51
219 0.47
220 0.47
221 0.5
222 0.51
223 0.56
224 0.58
225 0.54
226 0.51
227 0.53
228 0.52