Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W780

Protein Details
Accession S9W780    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
361-380DELKEPPRHPKYKSEPCRSFBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045877  ZFP36-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:1905762  F:CCR4-NOT complex binding  
GO:0003690  F:double-stranded DNA binding  
GO:0044692  F:exoribonuclease activator activity  
GO:0046872  F:metal ion binding  
GO:0035925  F:mRNA 3'-UTR AU-rich region binding  
GO:0062104  F:pumilio-response element binding  
GO:0140610  F:RNA sequestering activity  
GO:0031138  P:negative regulation of conjugation with cellular fusion  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0031139  P:positive regulation of conjugation with cellular fusion  
GO:0060213  P:positive regulation of nuclear-transcribed mRNA poly(A) tail shortening  
GO:0110044  P:regulation of cell cycle switching, mitotic to meiotic cell cycle  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MVYSPVSRPQVPLTFRQWPPYDYKTDPLTIPRFPSANPLQNNSSMPTPSSLLDTYGSSLLSKSANTLGSLKPASNAVLSPDETFPSTVMPQYRSMDVGTPRSPDADGWPWHLTSSNSPQGYAWPPTFTPNGSTNHLHTSSRNLNDYPSPISSLESLPSKSSVGSSGLDYHTLPSSFNDDTKPTAFPLNMAGVPLSDASSQPSFAFAQNSVDRVFNPKPKLYYPSKSMTNVHNSIAKPALSRQSYSSGSIPLKSSLNTAVSAQPSALSNQISPVVGSPVLNSSKFSVSAPRADQLSPELQQLKQTNVPSVSQRPRAATPGSNNSSTTSTGKRALYKTEPCKNWQTTGNCRYGNKCQFAHGEDELKEPPRHPKYKSEPCRSFMLYGYCPYGLRCCFLHDEQGLINSQQNNIQEAVNADIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.58
4 0.54
5 0.5
6 0.54
7 0.53
8 0.52
9 0.46
10 0.5
11 0.46
12 0.45
13 0.45
14 0.45
15 0.44
16 0.41
17 0.42
18 0.41
19 0.38
20 0.35
21 0.42
22 0.42
23 0.46
24 0.45
25 0.46
26 0.46
27 0.48
28 0.5
29 0.43
30 0.38
31 0.3
32 0.27
33 0.24
34 0.22
35 0.19
36 0.21
37 0.19
38 0.17
39 0.17
40 0.17
41 0.17
42 0.16
43 0.16
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.11
50 0.14
51 0.14
52 0.16
53 0.19
54 0.18
55 0.23
56 0.24
57 0.22
58 0.19
59 0.2
60 0.19
61 0.17
62 0.16
63 0.14
64 0.16
65 0.17
66 0.18
67 0.18
68 0.18
69 0.18
70 0.18
71 0.15
72 0.14
73 0.14
74 0.15
75 0.17
76 0.19
77 0.22
78 0.24
79 0.25
80 0.23
81 0.23
82 0.25
83 0.25
84 0.29
85 0.26
86 0.26
87 0.26
88 0.26
89 0.25
90 0.21
91 0.23
92 0.24
93 0.23
94 0.26
95 0.28
96 0.26
97 0.26
98 0.27
99 0.23
100 0.22
101 0.28
102 0.3
103 0.28
104 0.29
105 0.29
106 0.31
107 0.34
108 0.32
109 0.25
110 0.2
111 0.2
112 0.23
113 0.25
114 0.21
115 0.21
116 0.22
117 0.24
118 0.27
119 0.28
120 0.27
121 0.31
122 0.32
123 0.29
124 0.25
125 0.29
126 0.32
127 0.33
128 0.34
129 0.29
130 0.29
131 0.3
132 0.32
133 0.27
134 0.2
135 0.2
136 0.17
137 0.18
138 0.17
139 0.16
140 0.16
141 0.15
142 0.15
143 0.13
144 0.14
145 0.13
146 0.12
147 0.12
148 0.11
149 0.11
150 0.11
151 0.11
152 0.13
153 0.13
154 0.14
155 0.13
156 0.13
157 0.12
158 0.12
159 0.11
160 0.09
161 0.13
162 0.13
163 0.14
164 0.14
165 0.14
166 0.16
167 0.17
168 0.17
169 0.14
170 0.15
171 0.14
172 0.12
173 0.13
174 0.13
175 0.12
176 0.11
177 0.1
178 0.08
179 0.08
180 0.08
181 0.07
182 0.05
183 0.05
184 0.07
185 0.08
186 0.08
187 0.08
188 0.1
189 0.1
190 0.1
191 0.11
192 0.09
193 0.13
194 0.13
195 0.15
196 0.14
197 0.13
198 0.13
199 0.18
200 0.21
201 0.22
202 0.25
203 0.26
204 0.27
205 0.29
206 0.35
207 0.35
208 0.36
209 0.35
210 0.37
211 0.39
212 0.39
213 0.4
214 0.38
215 0.39
216 0.36
217 0.33
218 0.33
219 0.29
220 0.28
221 0.27
222 0.23
223 0.17
224 0.18
225 0.23
226 0.19
227 0.2
228 0.2
229 0.24
230 0.24
231 0.26
232 0.24
233 0.22
234 0.22
235 0.23
236 0.22
237 0.19
238 0.18
239 0.16
240 0.17
241 0.14
242 0.15
243 0.14
244 0.14
245 0.15
246 0.15
247 0.15
248 0.13
249 0.12
250 0.11
251 0.11
252 0.12
253 0.09
254 0.09
255 0.1
256 0.11
257 0.1
258 0.1
259 0.09
260 0.09
261 0.09
262 0.09
263 0.08
264 0.11
265 0.13
266 0.13
267 0.14
268 0.15
269 0.15
270 0.16
271 0.16
272 0.19
273 0.19
274 0.24
275 0.25
276 0.25
277 0.25
278 0.25
279 0.25
280 0.21
281 0.23
282 0.19
283 0.21
284 0.21
285 0.2
286 0.26
287 0.27
288 0.28
289 0.29
290 0.29
291 0.29
292 0.29
293 0.3
294 0.29
295 0.37
296 0.4
297 0.42
298 0.43
299 0.42
300 0.43
301 0.45
302 0.44
303 0.4
304 0.4
305 0.42
306 0.44
307 0.42
308 0.4
309 0.38
310 0.37
311 0.34
312 0.31
313 0.25
314 0.24
315 0.28
316 0.31
317 0.35
318 0.35
319 0.39
320 0.44
321 0.5
322 0.56
323 0.6
324 0.6
325 0.59
326 0.66
327 0.63
328 0.59
329 0.58
330 0.56
331 0.57
332 0.61
333 0.64
334 0.59
335 0.58
336 0.59
337 0.61
338 0.62
339 0.59
340 0.51
341 0.48
342 0.49
343 0.49
344 0.49
345 0.42
346 0.39
347 0.33
348 0.36
349 0.35
350 0.36
351 0.35
352 0.32
353 0.39
354 0.43
355 0.49
356 0.49
357 0.56
358 0.62
359 0.71
360 0.8
361 0.8
362 0.77
363 0.74
364 0.78
365 0.7
366 0.62
367 0.55
368 0.52
369 0.44
370 0.39
371 0.4
372 0.33
373 0.3
374 0.29
375 0.32
376 0.25
377 0.26
378 0.23
379 0.25
380 0.3
381 0.32
382 0.38
383 0.32
384 0.33
385 0.31
386 0.34
387 0.31
388 0.26
389 0.29
390 0.22
391 0.23
392 0.24
393 0.25
394 0.25
395 0.24
396 0.23
397 0.19
398 0.19