Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9WZK0

Protein Details
Accession S9WZK0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-47EEPERAGLEKQKKRKSKKKTKNEPGCTQEKWBasic
NLS Segment(s)
PositionSequence
20-37ERAGLEKQKKRKSKKKTK
Subcellular Location(s) mito 10, cyto_nucl 9.5, cyto 9, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MSSFFKSLFSKRESTKEEPERAGLEKQKKRKSKKKTKNEPGCTQEKWDELVESGENLSGVDHPFPVTKEELKKHNTKEDCWIAVRGKVYNVTTYLPYHPDGAKKILKHAAIDATGQYMKAHDYVNEEEMLKTCFVGPLAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.64
4 0.65
5 0.6
6 0.59
7 0.53
8 0.48
9 0.48
10 0.46
11 0.47
12 0.5
13 0.57
14 0.64
15 0.71
16 0.79
17 0.82
18 0.85
19 0.86
20 0.89
21 0.91
22 0.92
23 0.94
24 0.95
25 0.94
26 0.91
27 0.86
28 0.81
29 0.71
30 0.64
31 0.56
32 0.46
33 0.39
34 0.31
35 0.25
36 0.19
37 0.19
38 0.14
39 0.11
40 0.1
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.1
54 0.13
55 0.18
56 0.21
57 0.26
58 0.3
59 0.36
60 0.37
61 0.44
62 0.42
63 0.39
64 0.43
65 0.41
66 0.39
67 0.34
68 0.35
69 0.27
70 0.28
71 0.28
72 0.2
73 0.17
74 0.19
75 0.18
76 0.16
77 0.16
78 0.15
79 0.16
80 0.17
81 0.18
82 0.17
83 0.17
84 0.18
85 0.18
86 0.2
87 0.21
88 0.26
89 0.28
90 0.26
91 0.31
92 0.34
93 0.34
94 0.32
95 0.32
96 0.29
97 0.26
98 0.26
99 0.21
100 0.18
101 0.17
102 0.16
103 0.14
104 0.11
105 0.11
106 0.12
107 0.13
108 0.11
109 0.16
110 0.19
111 0.21
112 0.22
113 0.22
114 0.21
115 0.21
116 0.22
117 0.17
118 0.14
119 0.12
120 0.12