Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9WZF8

Protein Details
Accession S9WZF8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SMESRRGRPPTRRQHLFTKDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MSMESRRGRPPTRRQHLFTKDLKSLMYAFGDDINPAADSVNVLEEIVVDYINEMCLEAARIAGNRNKVKVDDFKFALRNDPKKLGRVEELLVLQKMIADTRNVMKYNKDHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.8
4 0.79
5 0.75
6 0.7
7 0.63
8 0.56
9 0.51
10 0.42
11 0.35
12 0.28
13 0.22
14 0.16
15 0.12
16 0.13
17 0.13
18 0.11
19 0.1
20 0.09
21 0.08
22 0.07
23 0.07
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.07
49 0.1
50 0.18
51 0.19
52 0.21
53 0.22
54 0.22
55 0.26
56 0.32
57 0.34
58 0.32
59 0.32
60 0.35
61 0.37
62 0.37
63 0.42
64 0.41
65 0.42
66 0.42
67 0.48
68 0.47
69 0.48
70 0.51
71 0.46
72 0.42
73 0.39
74 0.36
75 0.31
76 0.31
77 0.29
78 0.26
79 0.22
80 0.18
81 0.16
82 0.15
83 0.12
84 0.11
85 0.1
86 0.13
87 0.19
88 0.25
89 0.27
90 0.28
91 0.33